(data stored in ACNUC8465 zone)

EMBL: FN543502.COAE

FN543502.COAE        Location/Qualifiers
FT   CDS_pept        complement(128392..129012)
FT                   /transl_table=11
FT                   /gene="coaE"
FT                   /locus_tag="ROD_01081"
FT                   /product="dephospho-CoA kinase"
FT                   /EC_number="2.7.1.24"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01081"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86888"
FT                   /db_xref="GOA:D2TGN9"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGN9"
FT                   /protein_id="CBG86888.1"
FT                   /translation="MRYTVALTGGIGSGKSTVANAFADLGVQIVDADIIARQVVAPGQP
FT                   ALEAIASRFGKALIGADGTLQRRLLRERIFANPQEKAWLNALLHPLIHQETQRQFRQAT
FT                   SSYVLWVVPLLVENGLHSKANRVLVVDVSAETQLSRTMLRDDVTRAHVEQILAAQATRE
FT                   ARLAVADDVIDNNGAPESIKPDVARLHALYLQLASQFVSQEKP"
     atgaggtata cggtagcctt aacgggcggc attggcagcg gtaagagcac cgttgcgaac        60
     gcatttgctg acctcggcgt tcagatcgtt gacgcagaca ttattgcccg tcaggtggtc       120
     gctccgggcc agcctgcgct ggaggccatt gccagtcgct tcggcaaagc gctgattggc       180
     gcggacggca cgctccagcg gcggcttctc cgcgagcgaa ttttcgcaaa tccgcaggaa       240
     aaagcctggc ttaacgccct gctccatcca cttattcacc aggaaacgca gcgtcagttc       300
     cggcaggcaa cttcttcgta tgtgttatgg gttgtgccgc tgctggttga aaatggcctg       360
     cacagcaaag caaatcgtgt gctcgtggtg gatgtctctg ccgaaacaca gctttcccga       420
     accatgctgc gcgacgacgt cacccgcgcg catgttgaac agatccttgc agcccaggcg       480
     acgcgtgaag cgcgtcttgc cgtggcggat gatgttattg ataataatgg cgcaccagag       540
     tccatcaagc cggatgtcgc ccgcctgcac gcgctttatc tccagcttgc gtcgcagttt       600
     gtctcacagg aaaaaccgta a                                                 621
//

If you have problems or comments...

PBIL Back to PBIL home page