(data stored in ACNUC8465 zone)

EMBL: FN543502.FBPC

FN543502.FBPC        Location/Qualifiers
FT   CDS_pept        complement(453123..454169)
FT                   /transl_table=11
FT                   /gene="fbpC"
FT                   /locus_tag="ROD_04041"
FT                   /product="Fe(3+) ions import ATP-binding protein FbpC (ec
FT                   3.6.3.30)"
FT                   /EC_number="3.6.3.30"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_04041"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87186"
FT                   /db_xref="GOA:D2TK56"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR015853"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2TK56"
FT                   /protein_id="CBG87186.1"
FT                   /translation="MSQKNFVELRNVSKRFGSNTVIDNINLTIPQGQMVTLLGPSGCGK
FT                   TTILRLVAGLEKPSDGQIFIDGEDVTHRSIQQRDICMVFQSYALFPHMSLGDNVGYGLK
FT                   MLGVSRAEVKARVKEALAMVDLEGFADRYVDQISGGQQQRVALARALILKPKVLLFDEP
FT                   LSNLDANLRRSMRDKIRELQKQFNITSLYVTHDQSEAFAVSDTVLVMNKGHIMQIGSPQ
FT                   DLYRQPASRFMASFMGDANLFPATFSAQAVEIYGYRLPRPAHFVAEGSGTVGVRPEAIT
FT                   LSDRGEESQRCTIRHVAYMGPQYEVTVEWHGQEILLQVNATRLQPDVGEHYYLEIHPYG
FT                   MFVLADAA"
     atgagtcaga aaaattttgt tgaactgcgc aacgtcagca aacgattcgg cagcaacacg        60
     gtcatcgaca acattaacct caccatcccg cagggacaga tggtgacgct gctcggcccg       120
     tccggctgtg gcaaaaccac cattctgcgg ctggttgccg gtctggagaa accgagcgac       180
     gggcagattt ttattgatgg cgaagatgtg acccatcgct ctattcagca gcgtgacatc       240
     tgcatggtgt ttcagtccta cgccctgttt ccgcatatgt cgctgggcga caacgtcggc       300
     tacgggttga aaatgcttgg cgtatcgcgc gccgaagtga aagcgcgggt aaaagaggcg       360
     ctggcgatgg tcgatctgga agggtttgca gaccgctatg tcgatcagat ctccggcggt       420
     cagcagcagc gcgtggcgct ggcgcgcgcg ctgatcctca agccgaaggt gctgctgttt       480
     gatgagccgc tgagtaacct ggatgccaac ctgcggcgca gtatgcgcga taaaattcgc       540
     gagctgcaaa agcagttcaa tattacgtcg ctgtacgtca cccacgatca gagcgaggct       600
     tttgcggttt ccgacacggt gctggtgatg aacaagggac atattatgca gatcggctcg       660
     ccgcaggatc tttatcgtca gcccgcgtcg cgctttatgg cgagctttat gggcgacgcc       720
     aacctctttc cggcgacctt cagcgcgcag gcggtggaga tttacggcta ccggctgccg       780
     cgaccggcgc attttgtcgc cgaaggaagc ggcaccgtcg gcgtgcgccc ggaagcgatc       840
     accttaagcg accgcggcga ggagagccag cgctgtacaa tccgccatgt ggcctatatg       900
     ggaccgcagt atgaagtgac ggtggagtgg cacgggcagg agattttatt gcaggtcaac       960
     gccacgcgcc tgcagccgga cgtcggcgag cactattatc tggagatcca cccgtacggc      1020
     atgtttgtat tagccgacgc ggcgtga                                          1047
//

If you have problems or comments...

PBIL Back to PBIL home page