(data stored in ACNUC8465 zone)

EMBL: FN543502.FHUC

FN543502.FHUC        Location/Qualifiers
FT   CDS_pept        185835..186632
FT                   /transl_table=11
FT                   /gene="fhuC"
FT                   /locus_tag="ROD_01551"
FT                   /product="ferrichrome transport ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01551"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86935"
FT                   /db_xref="GOA:D2TI39"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2TI39"
FT                   /protein_id="CBG86935.1"
FT                   /translation="MQEQTHHPDTTFALRDVTFRVPGRTLLHPLSLTFPVGKVTGLIGH
FT                   NGSGKSTLLKMLGRHQPPSEGEILLDAQPLESWSSKAFARKVAYLPQQLPPAEGMTVRE
FT                   LVAIGRYPWHGALGRFGIADREKVEEAITLVGLKPLAHRLVDSLSGGERQRAWIAMLVA
FT                   QDSRCLLLDEPTSALDIAHQVDVLALVHRLSQQRGLTVIAVLHDINMAARYCDYLVALR
FT                   GGEMIAEGTPAALMRGETLEQIYGIPMGILPHPAGAAPVSFVY"
     atgcaggaac agacccatca tcccgatacc acctttgcac tgcgtgatgt caccttccgc        60
     gtgccggggc gcacgcttct gcatcctctg tcgttaacct ttcctgtcgg taaagtgacg       120
     ggcctgattg gtcataacgg ctcaggaaaa tccactctgc tgaaaatgct tggtcgccat       180
     cagccgccgt cggaagggga gatcctgctg gacgcccagc cgctggagag ctggagcagc       240
     aaagcgtttg cccgcaaggt ggcttatctg ccgcagcagc tgccgcccgc ggaagggatg       300
     actgtgcggg aactggtggc gattggccgc tatccgtggc acggggcgct ggggcgcttt       360
     ggcattgcgg acagagaaaa agtggaagag gcgattacgc tggtggggct gaaaccgctg       420
     gcgcatcgtc tggtggacag cctctccggc ggcgaacggc agcgggcgtg gattgcgatg       480
     ctggtggcgc aggacagccg ctgtctgctg ctggatgaac cgacctcggc gctggatatc       540
     gcccatcagg tggacgtgct ggcgctggtg caccgcttaa gccagcagcg cggcctgacg       600
     gtgattgccg tattgcacga catcaacatg gccgcccgct actgcgacta tctggtggcg       660
     ctgcgcggcg gcgaaatgat tgccgagggg acgcccgccg cgctgatgcg tggcgaaacc       720
     ctggagcaga tttatggtat tccgatgggg atcctgccgc atccggcggg cgccgccccg       780
     gtgagttttg tctattaa                                                     798
//

If you have problems or comments...

PBIL Back to PBIL home page