(data stored in ACNUC8465 zone)

EMBL: FN543502.FTSL

FN543502.FTSL        Location/Qualifiers
FT   CDS_pept        106798..107163
FT                   /transl_table=11
FT                   /gene="ftsL"
FT                   /locus_tag="ROD_00891"
FT                   /product="cell division protein FtsL"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00891"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86869"
FT                   /db_xref="GOA:D2TGE0"
FT                   /db_xref="InterPro:IPR011922"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGE0"
FT                   /protein_id="CBG86869.1"
FT                   /translation="MISRVTEALSKVKGSIGSNERHALPGVIGDDLLRFGKLPLCLFIC
FT                   IIVTAVTVVTTAHHTRLLTAQREQLVLERDALDIEWRNLILEENALGDHSRVERIATEK
FT                   LQMQHVDPSQENIVVQK"
     atgatcagca gagtgacaga agcccttagc aaagtgaagg gatcgatagg aagcaacgag        60
     cgccatgcct tgcctggcgt gatcggtgac gatcttttgc gattcgggaa gctgccgctc       120
     tgcctgttca tttgcatcat tgtcacggcg gtgacagtcg tcacaaccgc tcaccatacg       180
     cgtttattga ccgcgcaacg cgaacagctg gtgctggagc gcgatgcgct ggatatcgaa       240
     tggcgtaacc tgatccttga ggagaacgcg ctcggcgatc atagccgggt agaacggatc       300
     gcaacggaga agctacaaat gcagcatgtt gatccctcac aagaaaatat cgtagtgcaa       360
     aaataa                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page