(data stored in ACNUC8465 zone)

EMBL: FN543502.FTSQ

FN543502.FTSQ        Location/Qualifiers
FT   CDS_pept        118916..119746
FT                   /transl_table=11
FT                   /gene="ftsQ"
FT                   /locus_tag="ROD_00991"
FT                   /product="cell division protein FtsQ"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00991"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86879"
FT                   /db_xref="GOA:D2TGN0"
FT                   /db_xref="InterPro:IPR005548"
FT                   /db_xref="InterPro:IPR013685"
FT                   /db_xref="InterPro:IPR026579"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGN0"
FT                   /protein_id="CBG86879.1"
FT                   /translation="MSQAALNTRNSDEEVSSSRRNNGTRLAGILFLLTVLCTVLVSGWV
FT                   VLGWMEDAQRLPLSKLVLTGERHYTKNDDIRQSILALGAPGTFMTQDVNIIQSQIERLP
FT                   WIKQASVRKQWPDELKIHLVEYVPIARWNDQHMVDAEGNAFSVPSDRTSKQILPMLYGP
FT                   EGSASEVLQGYREMGQVLAKDRFTLKEAAMTARRSWQLTLNNDIKLNLGRGDTMKRLAR
FT                   FVELYPVLQQQAQTEGKRISYVDLRYDSGAAVGWEPLPPEETNQQQNQAQAEQQ"
     atgtcgcagg ctgcgctgaa cacgcgaaac agtgacgaag aggtttcttc atcacgtcgc        60
     aacaatggaa cgcgtcttgc aggaatttta tttctgctaa cggtgctgtg taccgtgttg       120
     gtcagcggct gggttgtgtt gggctggatg gaggacgcgc agcgtttacc gctgtcaaag       180
     ctggtattaa ccggcgagcg tcattacacg aaaaacgatg atatccgcca gtcgatcctg       240
     gcgctgggcg cgcccggaac gtttatgact caggatgtga acatcattca gagccagatt       300
     gaacgtttac cgtggattaa acaggccagc gtcagaaagc aatggcctga tgaattgaag       360
     attcatctgg ttgaatatgt gccaatagcg cgttggaatg atcagcatat ggtggatgcc       420
     gaaggaaatg cctttagcgt accgtcagat cgtaccagca agcagatttt accgatgctg       480
     tatggcccgg aaggcagcgc gagcgaagtg ttgcagggct atcgcgaaat gggacaggtg       540
     ctggcgaagg acaggtttac gttaaaggaa gcggcgatga ccgcacgtcg ttcctggcag       600
     ttgacgctga ataacgatat taagctcaac ctcggcaggg gcgatacaat gaaacgtttg       660
     gctcgctttg tagaactcta cccggtttta cagcagcagg cgcaaaccga gggcaaacgg       720
     attagctacg ttgatttgcg ttatgactca ggggcagcag taggctggga gcctttacct       780
     cctgaggaaa ctaatcagca acaaaatcag gcacaggcag aacaacaatg a                831
//

If you have problems or comments...

PBIL Back to PBIL home page