(data stored in ACNUC8465 zone)

EMBL: FN543502.FTSW

FN543502.FTSW        Location/Qualifiers
FT   CDS_pept        114160..115404
FT                   /transl_table=11
FT                   /gene="ftsW"
FT                   /locus_tag="ROD_00951"
FT                   /product="cell division protein FtsW"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00951"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86875"
FT                   /db_xref="GOA:D2TGM6"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR013437"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGM6"
FT                   /protein_id="CBG86875.1"
FT                   /translation="MRLSLPRLRMPRLPGVGLLGGILAALKGWVMGSRDKDTDSLVMYD
FT                   RMLLWLTFGLAAIGFVMVTSASMPVGQRLAGDPFLFAKRDALYILLAFCLAMITLRLPM
FT                   EFWQRYSTTMLIASIVMLLIVLVVGSSVNGASRWIAIGPLRIQPAEFTKLSLFCYLANY
FT                   LVRKVDEVRNNLRGFLKPMGVILVLAILLLAQPDLGTVVVLFVTTLAMLFLAGAKLWQF
FT                   IAIIGMGISAVVLLILAEPYRIRRVTSFWNPWEDPFGSGYQLTQSLMAFGRGEMWGQGL
FT                   GNSVQKLEYLPEAHTDFIFAIIGEELGYIGVVLALLMVFFVAFRAMSIGRKALQIDQRF
FT                   SGFLACSIGIWFSFQALVNVGAAAGMLPTKGLTLPLISYGGSSLLIMSTAIMMLLRIDY
FT                   ETRLEKAQAFTRGSR"
     atgcgtttat ctctccctcg cctgagaatg ccgcgcctgc cgggagtagg tctgctgggc        60
     gggatcctgg cggcgctgaa aggctgggtg atgggctcgc gggacaaaga taccgacagc       120
     ttggtgatgt acgatcgcat gctgctgtgg ctcacctttg gcctggcggc gatcggcttt       180
     gtgatggtga cctccgcatc catgccggtg ggacagcgcc tggcgggcga tccgttcctg       240
     tttgccaagc gtgatgcgct gtatattctg ctggcgtttt gtctggcaat gatcacgctg       300
     cgtctgccga tggagttctg gcagcgctac agcaccacga tgctgatcgc ctcgatcgtt       360
     atgctgctga tcgtactggt ggtcggcagt tcggtgaacg gggcatcgcg ctggatcgcg       420
     atcggcccgc tgcgtattca gccagcggag tttaccaagc tgtcgctgtt ctgctacctg       480
     gcgaactacc tggtgcgcaa ggttgacgaa gtgcgtaata acctgcgcgg ctttttaaag       540
     ccgatgggcg taatcctcgt actggcgatc ctgctgctgg cgcagcctga cctcggtacg       600
     gtggtggtgc tgttcgtcac caccctggcg atgctgtttc tggcgggcgc gaagctgtgg       660
     cagttcatcg ccattatcgg catggggatt tcggcagtgg tgctgctgat cctcgccgag       720
     ccataccgta ttcgccgcgt cacctcattc tggaatccgt gggaagatcc gttcggcagc       780
     ggttatcagc tcacccagtc cctgatggcg tttggccgcg gggaaatgtg ggggcagggg       840
     ctgggtaatt cggtgcagaa actggagtac ctgccggaag cgcacacgga ctttatcttc       900
     gccattattg gggaagaact gggttatatc ggtgtggtat tggcgctatt aatggtattc       960
     ttcgtcgctt ttcgcgcgat gtcgattggc cgcaaggcgt tacagattga tcagcgtttt      1020
     tccggctttt tagcctgttc gatcggcatc tggtttagct ttcaggcgct ggtcaacgtg      1080
     ggggcggcgg cgggcatgct gccaaccaaa ggtctgacgt tgccgctgat cagctacggc      1140
     gggtcaagcc tgttgattat gtcgacggca atcatgatgt tgctgcgtat agattatgaa      1200
     acgcgtctgg aaaaagccca ggcgtttaca cgaggttcac gatga                      1245
//

If you have problems or comments...

PBIL Back to PBIL home page