(data stored in ACNUC8465 zone)

EMBL: FN543502.GLND

FN543502.GLND        Location/Qualifiers
FT   CDS_pept        complement(201275..203947)
FT                   /transl_table=11
FT                   /gene="glnD"
FT                   /locus_tag="ROD_01701"
FT                   /product="[protein-PII] uridylyltransferase"
FT                   /EC_number="2.7.7.59"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01701"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86950"
FT                   /db_xref="GOA:D2TI54"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR010043"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="UniProtKB/TrEMBL:D2TI54"
FT                   /protein_id="CBG86950.1"
FT                   /translation="MNTLPEQHANTALPTLPGQPQNPGAWPRDDLTISGIKSHIDTFQQ
FT                   WLGDAFDGGVSAEQLIEARTEFIDQLLQRLWIEAGFGQIADLALVAVGGYGRGELHPLS
FT                   DIDLLILSRKKLPDAQAQKVGELLTLLWDVRLEVGHSVRTLEECLLEGLSDLTVATNLI
FT                   ETRLLIGDVALFLELQKHIFSEGFWPSDKFYAAKVEEQNQRHQRYHGTSYNLEPDIKSS
FT                   PGGLRDIHTLQWVARRHFGATSLDEMVGFGFLTQAERAELNECLHILWRIRFALHLVVS
FT                   RYDNRLLFDRQLSVAQRLNYSGEGNEPVERMMKDYFRVTRRVSELNQMLLQLFDEAILA
FT                   LPADEKPRPIDDDFQLRGTLIDLRHDDLFIREPEAILRMFYTMVRNSAITGIYSTTLRH
FT                   LRHARRHLNQPLCYIPEARSLFLSMLRHPGAISRGLLPMHRHSVLWAYMPQWSHIVGQM
FT                   QFDLFHAYTVDEHTIRVMLKLESFAREETRQRHPLCVDLWPRLRQPELIFIAALFHDIA
FT                   KGRGGDHSVLGAQDVLKFAELHGLNSRETQLVAWLVRQHLLMSVTAQRRDIQDPEVIKQ
FT                   FAEEVQTEHRLRFLVCLTVADICATNETLWNSWKQSLLRELYFATEKQLRRGMQNTPDM
FT                   RERVRHHQLQALALLRMDNIDEAALHHIWSRCRANYFVRHSPNQLAWHARHLLQHDLSK
FT                   PLILLSPQATRGGTEIFIWSPDRPYLFAAVCAELDRRNLSVHDAQIFTTRDGMAMDTFI
FT                   VLEPDGSPLSSDRHEAIRFGLEQAITQRSWQPPQPRRQPAKLRHFTVDTEVTFLPTHTD
FT                   RKSFLELIALDQPGLLARVGQIFADLGISLHGARITTIGERVEDLFIIATADRRALNNE
FT                   LQQEVHQRLTEALNPNDKG"
     atgaacacac ttcctgaaca gcacgcgaat acggcacttc ccacccttcc cggccagccg        60
     caaaaccccg gcgcctggcc gcgcgacgat ctcaccatca gcgggatcaa atcccacatc       120
     gatacttttc agcagtggct gggcgacgcc tttgacggcg gagtctccgc cgagcagctt       180
     attgaagccc gcaccgaatt tattgaccag ctgttgcagc gcctgtggat tgaggccggg       240
     ttcggccaga ttgccgatct ggcgctggtg gcggtcggcg gctacgggcg cggcgaactg       300
     cacccgcttt ccgacatcga tctgctgatc ttaagccgca aaaaactacc cgatgcgcag       360
     gcgcaaaaag tgggagaact gctgacgctg ctgtgggacg tcaggctgga ggtcgggcac       420
     agcgtgcgca ccctggaaga gtgtctgctg gaagggctgt cggatctgac tgtcgccacc       480
     aacctgatag aaacccggct gctgattggc gacgtggcgc tgttccttga actgcaaaaa       540
     cacattttca gcgaaggctt ctggccgtct gataagtttt acgccgcgaa agtggaggaa       600
     caaaaccagc gccaccagcg ctatcacggc accagctata acctcgagcc ggacatcaaa       660
     agcagccctg gcggcctgcg cgacatccac acgctacagt gggtcgcccg ccgccatttt       720
     ggcgccactt cgctcgatga aatggtcggc ttcggctttt taacccaggc cgagcgcgcc       780
     gaactgaatg agtgtctgca cattctctgg cgcatccgct ttgcgctgca tctggtggta       840
     agccgttacg ataaccgcct gctgtttgac cgtcagctca gcgtcgccca acgccttaac       900
     tacagcggcg aaggcaacga accggtcgag cggatgatga aggattactt ccgggtaacg       960
     cgccgggtca gcgagctgaa ccagatgctg ctccagctgt ttgacgaagc gatccttgcc      1020
     ctccccgccg acgaaaagcc gcgcccaatc gacgacgatt tccagctgcg cggcacgctg      1080
     atcgacctgc gccacgacga tctgtttatc cgcgaaccgg aagcgatcct gcgcatgttt      1140
     tacaccatgg tgcgtaacag cgcgatcacc gggatctact ccaccaccct gcgtcatctg      1200
     cgccatgccc gacgccacct gaaccagcca ctgtgctaca ttccggaagc gcgctcgctg      1260
     ttcctcagca tgttgcgtca ccccggcgcc atcagccgcg ggctgctgcc gatgcatcgt      1320
     cacagcgtgc tgtgggccta tatgccgcag tggtcgcaca ttgtcggaca gatgcagttt      1380
     gacctgttcc acgcttatac ggtggacgaa cacaccattc gcgtgatgct gaagctggaa      1440
     agcttcgcca gagaagagac gcgccagcgc cacccgctgt gcgtggatct ctggccgcgc      1500
     ctgcgccagc cggagctgat cttcatcgcc gcgctgttcc acgatatcgc caaaggacgc      1560
     ggcggcgacc actcggtgct tggcgctcag gacgtgctca aattcgccga actgcacggg      1620
     ctgaactcac gggagacaca gctggtcgca tggctggtgc gtcagcatct gctgatgtcg      1680
     gttaccgccc agcgccgcga tattcaggat ccggaagtta ttaagcagtt cgccgaagag      1740
     gtacagaccg agcaccgcct gcgctttctg gtctgcctga cggtggcgga tatctgcgcc      1800
     accaacgaaa cgctgtggaa cagctggaag caaagcctgc tgcgcgaact gtacttcgcc      1860
     acggaaaaac agctgcgtcg gggaatgcag aatacgccgg atatgcgcga gcgtgtgcgc      1920
     catcatcagc ttcaggcgct ggcgctgctg cggatggata atattgatga agcggcgctg      1980
     catcatatct ggtcgcgctg tcgcgccaac tattttgtcc gccacagccc aaaccagctg      2040
     gcctggcacg cccgccatct gctacagcat gacctgagca agccgttaat tttgctcagc      2100
     ccgcaggcga cgcgcggcgg aacggaaatt ttcatctgga gcccggaccg gccatacctg      2160
     ttcgccgcgg tctgcgctga actggacagg cgtaacctga gcgtccacga tgcgcaaatt      2220
     ttcaccaccc gcgacggcat ggcgatggat acgtttatcg tgctggagcc ggacggtagc      2280
     ccgctgtcat ccgatcggca tgaagcgatc cgcttcgggc tggagcaggc gatcacccag      2340
     cgcagctggc agccgccgca gccgcgtcgt caaccggcaa aattgcgtca ttttaccgtc      2400
     gataccgaag tgaccttcct gccgacgcat accgaccgaa aatcgttcct cgagctgatc      2460
     gccctcgacc agcccggact gctggcacgg gtcgggcaaa tttttgccga tctgggaatt      2520
     tcgcttcatg gcgcccgaat tacaaccatt ggcgagcgag tagaagattt attcataatc      2580
     gccaccgcgg accggcgtgc gcttaataat gagctgcagc aggaagtgca tcaacggttg      2640
     acagaggccc tcaatccaaa cgataaaggg tag                                   2673
//

If you have problems or comments...

PBIL Back to PBIL home page