(data stored in ACNUC8465 zone)

EMBL: FN543502.ILVI

FN543502.ILVI        Location/Qualifiers
FT   CDS_pept        101305..103029
FT                   /transl_table=11
FT                   /gene="ilvI"
FT                   /locus_tag="ROD_00841"
FT                   /product="acetolactate synthase isozyme III large subunit"
FT                   /EC_number="2.2.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00841"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86864"
FT                   /db_xref="GOA:D2TGD5"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGD5"
FT                   /protein_id="CBG86864.1"
FT                   /translation="MEMLSGAEMVVRSLIDQGVKQVFGYPGGAVLDIYDALHTVGGIDH
FT                   VLVRHEQAAVHMADGLARATGEVGVVLVTSGPGATNAITGIATAYMDSIPLVILSGQVA
FT                   TSLIGYDAFQECDMVGISRPVVKHSFLVKQTEDIPQVLKKAFWLAASGRPGPVVVDLPK
FT                   DILNPAKKLPYTWPESVSMRSYNPTTAGHKGQIKRALQTLLSAKNPVAYVGGGAITAGC
FT                   HTQLQQLIETLNLPVVSSLMGLGAFPATHRQALGMLGMHGTYEANMTMHHSDVIFAVGV
FT                   RFDDRTTNNLAKYCPNATVLHIDIDPTSISKTVAADIPIVGDARQVLEQMLELLSQETA
FT                   AQPLDDIRDWWQQIERWRARQCLKYDAQSESIKPQAVIETLWRLTKGDAFVTSDVGQHQ
FT                   MFAALYYPFDKPRRWINSGGLGTMGFGLPAALGVKMALPDETVVCVTGDGSIQMNIQEL
FT                   STALQYELPVLVLNLNNRYLGMVKQWQDMIYSGRHSQSYMQSLPDFVRLAEAYGHVGIR
FT                   IARPDELEGQLSEALAQVQSGRLVFVDVTVDGSEHVYPMQIRGGGMDEMWLSKTERT"
     atggagatgt tgtctggagc cgagatggtc gtccgatcgc tcatcgatca gggcgttaag        60
     caggtattcg gttatcccgg gggcgcagtc ctcgatattt acgatgcgtt gcatacggtg       120
     ggcggtatcg atcacgtcct tgtccggcat gaacaggctg ccgtgcatat ggccgatggt       180
     ctggcgcgcg cgacgggcga agtaggcgtt gtactggtga cttctggccc tggcgccacc       240
     aatgcgatta ccggcatcgc caccgcctat atggattcga ttcctttagt tattctttcc       300
     ggccaggttg caacctcgct gatcggctac gacgcctttc aggagtgcga tatggtgggg       360
     atctcccgcc cggtggtgaa gcacagcttc cttgtaaaac agacggaaga tattccgcag       420
     gtgctcaaga aagccttctg gctggcggcg agcggtcgtc cggggccggt ggtggtcgat       480
     ttaccgaaag acatcctgaa tccggctaag aagcttccat atacttggcc ggagtcggtg       540
     agtatgcgct cttataaccc caccacggcg ggccataaag gacagattaa gcgtgcgctg       600
     caaacgctgc tgtcggcgaa aaatccggtg gcatatgtgg gcggcggggc gataacggcg       660
     ggctgtcata cgcaactgca acagcttatt gaaacgctca acctgccggt ggtctcctcg       720
     ctgatgggac tgggcgcttt cccggccacg caccgccagg cgctggggat gctgggtatg       780
     cacggtacct atgaagccaa catgaccatg catcattccg atgtcatttt cgccgtcggg       840
     gtgcgttttg acgatcgcac caccaacaat ctggcgaagt attgcccgaa tgcgacggta       900
     ttgcatattg atatcgaccc gacatccatc tccaagacgg ttgccgccga tattcctatc       960
     gtcggcgatg cccggcaggt gctggagcag atgctggaac tgctgtcgca ggagaccgcg      1020
     gcgcagccgc tggatgatat ccgcgactgg tggcaacaga ttgagcgctg gcgcgcccgc      1080
     cagtgcctga aatatgacgc ccaaagcgaa agcatcaaac cgcaggcggt gattgaaacc      1140
     ctctggcgac tgaccaaagg cgacgcgttt gtcacttcgg atgtcggcca gcatcagatg      1200
     ttcgccgccc tctattatcc tttcgacaag ccgcgccgct ggatcaactc cggcggcctc      1260
     ggtacgatgg gcttcggtct gcctgcggcg cttggggtga aaatggcgct gccggatgaa      1320
     accgttgttt gcgtcaccgg cgacggcagc attcagatga acattcagga gctgtcgacg      1380
     gcgcttcagt atgaactgcc ggtgctggtg ctgaacctca acaaccgtta tctgggaatg      1440
     gtgaaacagt ggcaggacat gatttactcc ggtcgccact ctcagtctta tatgcagtcg      1500
     cttcccgatt tcgttcgcct tgccgaagca tacgggcacg tcggcatccg catcgcgcgt      1560
     cctgatgagc tggaggggca gctaagcgag gcgctggcgc aggtgcaaag cggacgtctg      1620
     gtctttgtcg acgttaccgt cgacggcagc gaacacgttt atccgatgca gattcgcggc      1680
     ggcgggatgg acgaaatgtg gttaagcaaa acggagagaa cctga                      1725
//

If you have problems or comments...

PBIL Back to PBIL home page