(data stored in ACNUC8465 zone)

EMBL: FN543502.LAFB

FN543502.LAFB        Location/Qualifiers
FT   CDS_pept        347410..348729
FT                   /transl_table=11
FT                   /gene="lafB"
FT                   /locus_tag="ROD_03221"
FT                   /product="lateral flagellar hook associated protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03221"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87104"
FT                   /db_xref="GOA:D2TJ96"
FT                   /db_xref="InterPro:IPR003481"
FT                   /db_xref="InterPro:IPR010809"
FT                   /db_xref="InterPro:IPR040026"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ96"
FT                   /protein_id="CBG87104.1"
FT                   /translation="MINPRTIAQEIAYADVATQAANLQKQQSELDAESNGLDTLSSALN
FT                   DFQTAIDALNSDTDGPVTFSATANNDSATITANSQAQAGTYSFYVEQLAQAQQSTFDLS
FT                   DDTFSATGTFELTMGDSTMDIDLAAADQNGDGDGYIDASELVSAINHSDDNPGVSAALV
FT                   KTDGATTIMLTSETTGAQSAFSVSISGHDASGDTSATAPTLTEMTAAQDAIIHLGSATG
FT                   PAITNSTNTFNDVIPGVSMTFSEVTGENDDLTTFTVAEDSSGTQAKVQTFVDAYNTLVD
FT                   TVDSLTSSGSDSTSAGIFAGDSGLKSLTSQLDDLAHASYGGVSIVDYGITLDAHGHLQI
FT                   DSDAFNEAMEENPEGLTAIFVGDDSMVAQMDELMESYLDSSNGILTLRQQNIDDQQDKI
FT                   QSEADRLTETYNNNYERYVEEYTNTLIEVYTMQTSMAAFM"
     atgattaatc caagaacaat cgcgcaagag attgcctatg ccgatgtcgc cacccaggcg        60
     gcgaacctgc agaagcagca gtcggagctg gacgcggaaa gcaacggtct ggatacgcta       120
     agctcggcgc tgaacgactt tcagacggct attgatgcgc tgaacagcga taccgatggt       180
     ccggtcacct tttccgcgac cgcaaataat gactccgcca ccatcaccgc caactcgcag       240
     gctcaggcgg gcacctactc cttttatgtt gaacaactgg cgcaggcgca gcagtccact       300
     tttgacctga gtgacgacac cttttccgcc accggcacct tcgagctgac gatgggcgac       360
     agcacgatgg atatcgatct tgcggccgcc gaccagaacg gcgacggcga tggctatatt       420
     gacgccagcg aactggtcag cgccattaat cactccgacg acaatccggg cgtgtcagcg       480
     gcgctggtga aaactgacgg cgccaccacc atcatgctga cctcagagac caccggcgcg       540
     cagagcgctt tttccgtttc cattagcggt catgacgcct ctggcgacac cagcgccacc       600
     gcgccgacgc tgactgaaat gaccgccgcg caggacgcca ttatccatct cggcagcgca       660
     acgggcccgg cgatcacgaa cagtaccaac acctttaatg atgtgatccc cggcgtatcg       720
     atgaccttta gcgaagtcac cggcgaaaat gatgatctca ccaccttcac ggtggcggag       780
     gactccagcg gcacgcaggc gaaagtgcag actttcgttg acgcctacaa cacgctggtg       840
     gataccgtcg actccctgac ctccagcggc agcgacagca ccagcgcggg catcttcgcc       900
     ggcgactccg ggctgaaatc gctgaccagc cagttagacg atctcgcgca cgccagctat       960
     ggcggcgtat cgattgtgga ttacggcatt acccttgatg ctcacggcca cctgcagatc      1020
     gactccgacg cctttaacga agcgatggag gagaacccgg aggggcttac tgcgattttc      1080
     gtcggcgatg acagcatggt cgcgcaaatg gatgagctga tggagagcta tctcgactcc      1140
     agcaacggca ttctcaccct gcgtcagcag aacatcgacg atcagcagga caaaatccag      1200
     agcgaagccg atcggctgac cgagacctac aacaacaact atgagcgcta tgtggaggag      1260
     tacaccaata ccttaattga ggtgtacacc atgcaaacca gcatggctgc gtttatgtaa      1320
//

If you have problems or comments...

PBIL Back to PBIL home page