(data stored in ACNUC8465 zone)

EMBL: FN543502.LAFC

FN543502.LAFC        Location/Qualifiers
FT   CDS_pept        348763..349155
FT                   /transl_table=11
FT                   /gene="lafC"
FT                   /locus_tag="ROD_03231"
FT                   /product="lateral flagellar chaperone protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03231"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87105"
FT                   /db_xref="GOA:D2TJ97"
FT                   /db_xref="InterPro:IPR003713"
FT                   /db_xref="InterPro:IPR036584"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ97"
FT                   /protein_id="CBG87105.1"
FT                   /translation="MYDTQDGYSQYKEIDLAARTAAASPLELVLVLFSGLMDELERAKS
FT                   HIENKRFEKKAQSINKCIDILNALTSSLEFETGGELVVNLSRLYDHCVFRLYEASGELS
FT                   LEKIDEVILILSNLREGWDGLSEKLG"
     atgtacgaca cacaggacgg ttattcgcaa tacaaagaga tcgatctcgc cgcccgcacg        60
     gcggcggctt cgcccctgga gctggtgctg gtgctttttt ccggcctgat ggatgagctt       120
     gaacgcgcca aaagccatat cgaaaacaaa cgcttcgaga aaaaagcgca gagcatcaat       180
     aaatgtatcg acattctcaa tgccctgacc agctcgctgg agtttgagac cggcggcgag       240
     ctggtggtga atctgtcgcg gctgtatgac cactgcgtct ttcgcctgta tgaagccagc       300
     ggcgagctgt cgctggagaa gatcgacgaa gtgatcctca ttctgagcaa cctgcgtgaa       360
     ggctgggacg gcctgtctga aaagctgggt taa                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page