(data stored in ACNUC8465 zone)

EMBL: FN543502.LAFD

FN543502.LAFD        Location/Qualifiers
FT   CDS_pept        349160..349477
FT                   /transl_table=11
FT                   /gene="lafD"
FT                   /locus_tag="ROD_03241"
FT                   /product="lateral flagellar chaperone protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03241"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87106"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ98"
FT                   /protein_id="CBG87106.1"
FT                   /translation="MDRESQQRQLFALIDAMNEALDKQRWRRLPALRQQLMRQFAQYQA
FT                   QESSETELRAVKERLRAAFADLIERRSERAALLKARMDKHQQLQEGVLAYSMMTLISEK
FT                   A"
     atggacagag aaagccaaca gcggcagctc tttgcgctaa tcgatgcgat gaatgaagcc        60
     ctcgacaaac agcgctggcg gcggctgccc gcgctgcgcc agcagctgat gcgtcagttt       120
     gcgcaatatc aggcgcagga gagttcagag acggagctgc gcgcggtgaa agagcggctg       180
     cgcgccgcgt tcgccgacct gattgagcgg cgcagcgagc gcgcggcgct gctgaaagcg       240
     cgaatggata aacatcagca gctgcaggaa ggtgtgctgg cgtactcaat gatgacttta       300
     atttcggaga aggcatga                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page