(data stored in ACNUC8465 zone)

EMBL: FN543502.LAFF

FN543502.LAFF        Location/Qualifiers
FT   CDS_pept        350633..351097
FT                   /transl_table=11
FT                   /gene="lafF"
FT                   /locus_tag="ROD_03261"
FT                   /product="lateral flagellar associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03261"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87108"
FT                   /db_xref="GOA:D2TJA0"
FT                   /db_xref="InterPro:IPR005503"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJA0"
FT                   /protein_id="CBG87108.1"
FT                   /translation="MKRIVMASVISSIMALVVGGGAGWGVYHFAGNGKTATAAHAEAVE
FT                   KMDESKSIFVSLQETIVTLHDNDGADHYMSAELVMVVASEKESEQIKQQEPLYQSIAVE
FT                   RLSEMKYEEIRALKISEIRKLIAEALQKELKDRKIAAPYKDILVKKVVFQ"
     atgaaaagaa ttgttatggc gagtgtgatc agttccatca tggccctggt agtaggcggc        60
     ggggccggat ggggggtcta tcacttcgcg ggaaatggaa agacagccac cgcagcgcac       120
     gctgaggcgg tagaaaaaat ggatgagagc aagagtatct ttgtttcttt gcaggaaacg       180
     atcgtcaccc tgcatgacaa tgacggcgcc gatcactata tgtcggcgga gttagtcatg       240
     gtggtcgcca gtgaaaaaga gtcggagcag attaagcagc aggagccgct ctaccagagt       300
     attgcggtgg aacggctttc cgaaatgaaa tatgaagaaa ttcgcgcgct gaaaatttct       360
     gaaataagaa aactgatcgc cgaggcgctg caaaaagaat taaaggatcg caaaatcgcc       420
     gcgccttata aggatatttt ggtgaaaaag gtcgtgtttc aataa                       465
//

If you have problems or comments...

PBIL Back to PBIL home page