(data stored in ACNUC8465 zone)

EMBL: FN543502.LAFS

FN543502.LAFS        Location/Qualifiers
FT   CDS_pept        351118..351834
FT                   /transl_table=11
FT                   /gene="lafS"
FT                   /locus_tag="ROD_03271"
FT                   /product="lateral flagellar sigma factor 28 protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03271"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87109"
FT                   /db_xref="GOA:D2TJY1"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR012845"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJY1"
FT                   /protein_id="CBG87109.1"
FT                   /translation="MLQDAYESEEFSATPVLTPQQESHYLQAYLPLVRKVVRQLAPQCT
FT                   CVIDRQDMEQTALLGLLNAIRRYGMPDEGFAGYAIHRIRGAILDELRSLDWRPRLLRQK
FT                   YHQIKDLIRDMRKQLGREPEWQELSQTGLTPEDYLEFQQLEGAETLASLDELLSGEGHG
FT                   ALPEGRGLEEQFVNQEMLSYALGQLSEKEGLVLSMYYQHDMNLKEIALVLGLTEARICQ
FT                   MNKKITQKIRDCLYPD"
     atgttacagg acgcttacga gtcagaggaa ttcagcgcga ctcccgtgct gacgccgcag        60
     caggaaagtc attatttaca ggcttacctg ccgctggtga gaaaagtggt gcggcagctt       120
     gcgccgcagt gcacctgcgt gattgaccgg caggatatgg aacaaacggc gttgctggga       180
     ttactcaacg ccattcggcg ttatggcatg ccggatgaag gttttgcggg ctatgccatt       240
     caccgcatcc gcggggcgat cctcgatgag ctgcgcagtc ttgactggcg gcctcgtctg       300
     ctgcgtcaaa aatatcatca aatcaaagac ctgattcgcg atatgcgcaa gcagctcggg       360
     cgggagccgg agtggcaaga gctgtcgcag accggcctga cgccggagga ttatctggag       420
     tttcagcagc tggagggggc ggaaacgctg gccagccttg atgagctgct gagcggcgaa       480
     gggcatggcg cgctgccgga gggcaggggg ctcgaagagc agttcgtgaa ccaggagatg       540
     ctcagctacg ccctcggaca gctgagtgaa aaagaggggc tggtgctctc aatgtattac       600
     caacacgata tgaatttaaa agagatcgcg ttggttttag ggctgactga agccagaatt       660
     tgccaaatga ataaaaaaat cacgcagaaa attcgtgatt gtttatatcc agattaa          717
//

If you have problems or comments...

PBIL Back to PBIL home page