(data stored in ACNUC8465 zone)

EMBL: FN543502.LAFV

FN543502.LAFV        Location/Qualifiers
FT   CDS_pept        complement(331504..332448)
FT                   /transl_table=11
FT                   /gene="lafV"
FT                   /locus_tag="ROD_03011"
FT                   /product="lateral flagellar associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03011"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87084"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ77"
FT                   /protein_id="CBG87084.1"
FT                   /translation="MKMIECYEPDFVRTFLSRHPGSPLHTRQVWQDEIRHSLTLTDAAS
FT                   CEAAFGNPHAFALHTSQCEAMPDGQPLSLREQTLNQAALNAVTLPALQPELRLYALGIL
FT                   LSYSEKLPGNSEETLAQIASLPTSLANLARSGKLQQQFALLPSVPQLQCRLITLLGGQE
FT                   FDWQTLPDGARKISLPLQVSLLALQDANSEALLQQQLQAQWQETHERYFAHEAWIFSNY
FT                   LIYRLYHDMFPQHDGEGVAGRYFALACDFFLIRTLFSLWTLDGSSLSHADIFALFALFE
FT                   RWRHSESAAFLRRQAESRLPTDHLLSAFSLLIC"
     atgaagatga ttgaatgcta tgaaccggac tttgtccgca cgtttttgtc ccgccatccc        60
     ggctccccgc tgcatacccg tcaggtctgg caagatgaaa tccgccacag cctgacgcta       120
     accgacgccg ccagctgcga ggcggcgttc ggcaatccgc acgcctttgc gctgcatacc       180
     agccagtgcg aagccatgcc ggacggccag ccgctctccc tgcgcgagca gacgctgaac       240
     caggcggcgc tgaacgcggt caccctgccc gcactgcaac cggagctgcg cctctacgcg       300
     ctgggcattt tgctttcgta cagcgaaaaa ctgccgggca acagcgagga gacgctcgcg       360
     caaatcgcat cgctgccgac cagcctcgcc aaccttgccc ggtcggggaa attacagcaa       420
     cagttcgcgc tactgccgtc ggtgccgcaa ttacagtgcc ggttgatcac cctgctcggc       480
     ggccaggaat ttgactggca aacgctgcct gacggcgcgc gtaagataag cctgccactg       540
     caggtcagct tgctggcgct acaggatgcc aacagcgaag ccttattgca gcagcagcta       600
     caggcgcaat ggcaggagac gcatgagcgt tactttgccc acgaagcgtg gattttcagc       660
     aattacctga tttaccgtct gtatcacgat atgttcccac agcatgacgg agaaggcgtc       720
     gccggacgct atttcgcgct ggcatgtgac tttttcctga tccgtacgct gttcagcctc       780
     tggacgctcg acggttcgtc gctgagccat gcggatatct tcgcgctgtt cgccctgttt       840
     gaacgctggc ggcacagcga aagcgccgcc ttcctgcgcc gccaggccga aagccggttg       900
     ccgaccgacc acctgctgtc tgctttttca ttgctgattt gttag                       945
//

If you have problems or comments...

PBIL Back to PBIL home page