(data stored in ACNUC8465 zone)

EMBL: FN543502.LAFW

FN543502.LAFW        Location/Qualifiers
FT   CDS_pept        343303..344304
FT                   /transl_table=11
FT                   /gene="lafW"
FT                   /locus_tag="ROD_03171"
FT                   /product="lateral flagellar putative hook associated
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03171"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87099"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ91"
FT                   /protein_id="CBG87099.1"
FT                   /translation="MQVGLNTSSLSAGGALSSPVGQHAVAQNTPVRQKPSVVASDYPAS
FT                   PLIATRPQRYSVQLNDQITTLQQADHYLGQLEQQLLDYRHTTRRGGQGPQQKGTEIARL
FT                   LEQRVTLAGGAVDRQLKPVLQGEARVVFHAPELVQMVQERAPGGKMFRISDGRQTQLAA
FT                   VAVGEENDGGQYRVMMNNALRRVGIQLHERHGSVAFSTAEAKWPQIAQTLSVHQEGETP
FT                   SSFTPLNAFAEPSLADDLLQSVRQGGSRSGDAVQQALDTIGEQRAQMAVQQEKARQLID
FT                   KMARFPQAESAVQASTTLGGVLDNASHNYQILAQAVNGQARLSSQTVRNLLR"
     atgcaggttg gtttaaacac atcgtccctc tccgctggcg gagcccttag ctccccggtc        60
     ggacaacatg ccgtcgcgca gaatacgcct gtccgccaga agccgtccgt cgtcgccagc       120
     gattacccgg cctcgccgct gatcgccacg cggccccagc gctacagcgt ccagctcaac       180
     gatcaaatca ccacgctcca gcaggccgac cactatcttg gacagctgga gcaacagctg       240
     ctggactatc gccacaccac gcgacgcggt ggtcaggggc cgcagcaaaa gggaacggag       300
     attgcccggc tgctggagca gcgcgtcacg ttggcgggcg gcgcggtcga tcgccagctt       360
     aaaccggtgt tgcagggtga agcgcgggtc gtctttcatg cgccggaact ggtgcagatg       420
     gtgcaggagc gagcgccggg agggaagatg ttccgcattt ccgacggtcg tcagacgcag       480
     ctcgcggcgg tggcggtggg ggaagagaac gacggcggtc agtaccgggt aatgatgaat       540
     aacgctctgc gccgcgtcgg cattcagctg catgaacgcc acggttcggt cgctttctcc       600
     accgctgagg cgaagtggcc gcagatcgcg cagacgctga gcgtgcatca ggagggggaa       660
     acgccgtctt cctttacgcc gttaaacgcc tttgccgagc cgtcgctggc cgacgatctg       720
     ctgcaaagcg tgcgtcaggg cggttcccgc agcggcgatg ccgttcagca ggcgcttgat       780
     actattggcg agcagcgtgc gcagatggcg gtgcaacagg aaaaagcccg tcagctgatc       840
     gataaaatgg cccgttttcc gcaggcggaa agcgcggtac aggcttccac gacgctgggg       900
     ggcgtgctgg ataatgccag ccacaactat cagattctgg cgcaggcggt gaacggacag       960
     gcccggcttt caagccagac cgtacgtaat ttattacgtt aa                         1002
//

If you have problems or comments...

PBIL Back to PBIL home page