(data stored in ACNUC8465 zone)

EMBL: FN543502.LFGM

FN543502.LFGM        Location/Qualifiers
FT   CDS_pept        complement(333029..333316)
FT                   /transl_table=11
FT                   /gene="lfgM"
FT                   /locus_tag="ROD_03031"
FT                   /product="lateral flagellar anti-sigma factor 28 protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03031"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87086"
FT                   /db_xref="GOA:D2TJ79"
FT                   /db_xref="InterPro:IPR007412"
FT                   /db_xref="InterPro:IPR031316"
FT                   /db_xref="InterPro:IPR035890"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ79"
FT                   /protein_id="CBG87086.1"
FT                   /translation="MKITPTLSGNRPTPAAADAGNSSKNSAARGAVSATSLSADDITQA
FT                   GLQSAQQALNDDGQGDIDYDKVAQMQAALAAGELSVDTDQLAGDMLNFFR"
     atgaaaatta ccccgacact ctccggcaac cgcccgacgc cagcggccgc cgacgctggc        60
     aacagcagta aaaacagcgc cgcgcgcggt gccgtaagcg ccacgtcgct ttccgctgac       120
     gatatcaccc aggcgggatt gcagtcggcg caacaggcgc tgaacgacga cggccagggc       180
     gatatcgatt atgacaaagt ggctcagatg caggccgcgc tggcggcggg cgaactgagc       240
     gtcgataccg accagttagc cggcgatatg ctgaactttt tccgctaa                    288
//

If you have problems or comments...

PBIL Back to PBIL home page