(data stored in ACNUC8465 zone)

EMBL: FN543502.LFHB

FN543502.LFHB        Location/Qualifiers
FT   CDS_pept        complement(276903..278042)
FT                   /transl_table=11
FT                   /gene="lfhB"
FT                   /locus_tag="ROD_02281"
FT                   /product="lateral flagellar export/assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02281"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87008"
FT                   /db_xref="GOA:D2TJ06"
FT                   /db_xref="InterPro:IPR006135"
FT                   /db_xref="InterPro:IPR006136"
FT                   /db_xref="InterPro:IPR029025"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ06"
FT                   /protein_id="CBG87008.1"
FT                   /translation="MADSSSEEKTEKPSAQKLRKAREEGQIPRSKDMGLAASLFAAFMV
FT                   ISSSFPWYEDFVRESFVSVHQYAQEINNPAIVGQFLQHHLLIMAKFILTLLPMPAAALA
FT                   ASLIPGGWLFLPKKMLPDFSKVNPLKGIGRLFSAEHLVETGKMMVKAVVILVMLWLSLR
FT                   NNFASFLGLQALWFKQAVSDGLALYSSVMRNFVILFVFFAVIDVPLAKKMFTKGLKMTK
FT                   QEVKEEYKNQEGKPEVKARVRRLQRQLAMGQIRKVVPKADVVITNPTHYAVALQYDQSR
FT                   AAAPFVVAKGTDEIALYIRQVAAESQVEVVEFPKLARSVYYTTQINQQIPFQLYRAIAH
FT                   VLTYVLQMKHWRDGTQPRPLLNRHISIPKEVLKLDAENN"
     atggcggata gcagcagcga agaaaaaaca gaaaaaccct cggcgcaaaa gctgcgcaaa        60
     gccagggaag aaggacagat cccgcgctca aaggacatgg ggctggcggc cagccttttt       120
     gccgccttta tggtcatcag cagcagtttt ccctggtatg aagatttcgt gcgcgaaagc       180
     ttcgtcagcg tccatcagta cgcgcaggag attaataacc cggcgatcgt cggacagttt       240
     ttgcagcatc acctgctgat tatggcgaaa tttattctca ccctgctgcc catgcccgcc       300
     gcggcgctgg cggcgtcgtt aattcccggc ggctggttgt tcctgccgaa gaagatgttg       360
     cccgacttca gcaaagtgaa tccgctgaaa ggcattggcc gcctgttttc ggcggagcat       420
     ctggtggaaa ccggcaagat gatggtgaaa gccgtggtga ttctggtgat gctgtggctg       480
     agcctgcgga ataacttcgc ctcgtttctc ggcctgcagg cgctctggtt taaacaggcg       540
     gtcagcgacg gcctggcgct ctacagcagc gtaatgcgca acttcgtcat cctgtttgtt       600
     ttctttgccg ttatcgacgt gccgctggcg aagaagatgt tcaccaaagg actgaagatg       660
     acaaaacagg aggtgaagga ggagtacaaa aaccaggagg gtaagcccga agtgaaggcc       720
     cgcgtgcgcc gtctgcaacg acagctggcg atggggcaga tccgcaaggt ggtgccgaaa       780
     gccgacgtag taatcaccaa cccgacccac tacgccgtgg cgctccagta cgaccagtcg       840
     cgcgccgccg caccgtttgt ggtggcgaaa ggcaccgacg aaatcgccct ctatatccgc       900
     caggtggcgg cggaaagcca ggtggaggtg gtggagtttc caaagctggc gcgctccgtc       960
     tactacacca cgcagattaa ccaacagatt ccctttcagc tctaccgggc gattgcccat      1020
     gtgctgacct atgtgttgca gatgaagcac tggcgtgacg gcacgcagcc tcgtccgttg      1080
     ctgaacagac atatttccat tcccaaagag gttcttaaac tggatgccga aaacaattaa      1140
//

If you have problems or comments...

PBIL Back to PBIL home page