(data stored in ACNUC8465 zone)

EMBL: FN543502.LFIF

FN543502.LFIF        Location/Qualifiers
FT   CDS_pept        283079..284743
FT                   /transl_table=11
FT                   /gene="lfiF"
FT                   /locus_tag="ROD_02371"
FT                   /product="lateral flagellar M-ring protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02371"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87016"
FT                   /db_xref="GOA:D2TJ14"
FT                   /db_xref="InterPro:IPR000067"
FT                   /db_xref="InterPro:IPR006182"
FT                   /db_xref="InterPro:IPR013556"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ14"
FT                   /protein_id="CBG87016.1"
FT                   /translation="MNELIKKLTHSFPAFAFRLDGNRRWMLLAAAAVAATAIIVSLLWN
FT                   SNHGYVSLYGRQENLPVSQIVTVLDGEKLEYRIDPQSGQILVPEEALSKTRMALAAKGV
FT                   QALLPNGYELMDKDEVLGSSQFVQNIRYKRSLEGELAQSIMTLDAVESARVHLALNEES
FT                   SFVVSDRPQNSASVVVRLHYGAKLDMDQVNAIVHLVSGSIPGLKATQVSVVDQAGNLLT
FT                   DGTGAGEAVAATTRKHDQILQDIQDKTRASVANVLDSLVGPGNYRISVMPDLDLSDIDE
FT                   TREHYGNEPKVNREENVQDSDTNQIAMGIPGSLSNRPPVAPNQVTNNASATTAESNPPQ
FT                   ALSKHSESKRDYSYDRSVQHIQYPGFTVKRLKVAVVLNQEAPALKNWTPEQTRQLTDLL
FT                   NNAAGIDTQRGDNLSLSLLRFVPPKTPVEPVIPLWKDESVLAWARMIGCGLLALLLLLF
FT                   VVRPMMKRLTAVRQSLPALEKVAASVPAIEPQFAAAEDDRKSIELPSFPGDDSLPPQSS
FT                   GLEVKLEFLQKLAMSDTDRVAEVLRQWITSNERIDNK"
     atgaatgaac tgattaagaa gctcacgcac tccttcccgg cattcgcttt ccggctggac        60
     ggcaacaggc gctggatgct gctggcggcg gccgccgtcg ccgcaacggc gattatcgtc       120
     agcctgctgt ggaacagcaa tcacggctac gtttcgctgt atggccgcca ggagaacctg       180
     cccgtttcgc agatcgtcac cgttctggac ggcgagaagc tggaataccg catcgacccg       240
     caaagcggcc agattctggt gccggaagag gcgctgtcga aaacgcgtat ggcccttgcc       300
     gccaaagggg tacaggcgct gttgcccaac ggctacgagt tgatggataa agacgaggtg       360
     ctgggcagca gccagttcgt gcagaacatc cgctacaagc gcagccttga aggcgagctg       420
     gcgcaatcga ttatgaccct cgacgcggtg gaaagcgccc gcgttcatct ggcgctgaat       480
     gaagaaagtt cgtttgtggt cagcgacagg ccgcagaaca gcgcctcggt ggttgtacgt       540
     ctgcactacg gcgcgaaact ggatatggat caggttaacg ccattgtgca tctggtttcc       600
     ggcagcattc cggggctgaa ggccacgcag gtaagcgtgg tcgatcaggc cgggaatctg       660
     ctgacggacg gaacaggggc gggcgaggcg gtcgccgcca ccacccgtaa gcacgaccag       720
     atcctgcagg atattcagga taaaacccgc gccagcgtcg ctaacgtgct ggactcgctg       780
     gtggggccgg gcaactaccg gatcagcgtg atgccggacc tcgatctgag cgatatcgac       840
     gaaacccggg agcactacgg caacgagccg aaggtcaatc gcgaagagaa cgttcaggac       900
     agcgacacca accagattgc gatgggcatt cccggttcgt taagcaaccg gccgccggtc       960
     gccccgaacc aggtgacgaa taacgccagc gcaacaactg cggagagcaa cccgccgcag      1020
     gcgctgtcga aacacagcga aagcaagcgt gactactcct acgaccgtag cgtgcagcat      1080
     attcagtacc cgggcttcac ggtgaaacgg ctgaaggtgg cggtggtgct taaccaggag      1140
     gcgccagcgc tgaagaactg gacgccagag cagaccagac agctgactga tctgctgaac      1200
     aatgccgccg ggatcgacac tcagcgcggc gacaatctgt cgctgtcgct gctccgtttc      1260
     gtgccgccaa agacgccggt cgagccggtt atcccgctgt ggaaggatga gagcgtactg      1320
     gcgtgggcgc ggatgattgg ctgcggcctg ctggcgctat tgctgctgct gtttgtcgtg      1380
     cggccaatga tgaagcgcct gaccgcggtg cgtcagagct tgcctgcgct ggagaaggtt      1440
     gcggccagcg tgcccgccat cgaaccgcag ttcgcggcgg cggaggatga tcggaaaagc      1500
     attgagcttc cctctttccc cggcgatgac agtctgcctc cgcagagttc cggcctggag      1560
     gtgaagctgg agttcctgca aaaactggcg atgagcgata ccgatcgcgt ggctgaagtt      1620
     ctcagacaat ggattaccag caatgagcga attgacaaca agtaa                      1665
//

If you have problems or comments...

PBIL Back to PBIL home page