(data stored in ACNUC8465 zone)

EMBL: FN543502.MCHD

FN543502.MCHD        Location/Qualifiers
FT   CDS_pept        complement(407818..409143)
FT                   /transl_table=11
FT                   /gene="mchD"
FT                   /locus_tag="ROD_03721"
FT                   /product="putative microcin secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03721"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87154"
FT                   /db_xref="GOA:D2TK24"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010130"
FT                   /db_xref="UniProtKB/TrEMBL:D2TK24"
FT                   /protein_id="CBG87154.1"
FT                   /translation="MQFRELHNALLALLLFFISHDAASLTLQQAILAADSYDTGIRAAR
FT                   ELNEAEQQKRLQGFSGLLPQINLTGGYSKQDQPKAAYAAGVTRHNYSINLSQPIFDIEK
FT                   YATWRRAEAMADQGQINYMLMQQQLITDVSEAWFSVAYASQALKNAERTRNAFQQQLRQ
FT                   ARRGLELGEQTRLEVDEALANYDNAAVEIIIAENDLNNARIRFTKITGLPGDTVPLNNM
FT                   ECFVSPQLPDLKKVKIHSNQNNLNVQLARFTLDQSKADVIASTSNHLPVVTLQAAYGNN
FT                   WSRGENENDFDFLFGTTSKTRNTNIGINVSIPIFAGGGHIAQSIEAAHRKEQSRELLLD
FT                   AQRKALEEAERAWYAIIANDAKIRALQKSIASAKKRLESTTYGKQIGQRTVLDMLNAES
FT                   DYYKSLKELAKARYDYITANIQLAKATGELDYAYLTKFSCST"
     atgcaattca gagaattaca caacgctttg ctggcgctat tactcttttt tatcagccat        60
     gacgcagcat ccctgacgct ccaacaggcc atactggccg ccgatagtta cgatactggt       120
     atacgcgcgg cgcgtgaact taacgaagcg gagcaacaaa agcgactgca gggcttctcg       180
     ggcttattac cacagataaa tcttactggg gggtattcta aacaggatca gccaaaagct       240
     gcctatgccg cgggggtaac ccgccataac tacagcatca atttaagcca gccgattttt       300
     gatatcgaaa aatatgccac ctggagacgt gcagaggcga tggccgatca ggggcagatt       360
     aattatatgt tgatgcaaca gcagcttatt accgacgtga gcgaagcctg gttttcagta       420
     gcttatgcct ctcaggcgct aaaaaatgcg gaacgtaccc ggaacgcgtt ccagcagcag       480
     ttacggcagg cacgacgggg gctggagctt ggagaacaaa cgcgacttga ggttgatgaa       540
     gccctggcta actacgataa cgccgcggta gagattatta ttgccgaaaa cgatctcaat       600
     aacgccagga tccgctttac aaaaatcacg gggctgccgg gggataccgt gccgcttaat       660
     aacatggagt gcttcgtatc gccgcagctt cccgacctta aaaaagtgaa gatccacagc       720
     aatcaaaata atctcaacgt acagctagcc cggttcactc ttgatcaaag caaggccgac       780
     gttatcgcca gcacgagtaa ccacctaccg gttgtcaccc tgcaggctgc ctatggtaac       840
     aactggagtc ggggagaaaa tgaaaacgac ttcgattttc tgtttggtac aacgtccaag       900
     acgcgaaaca ccaatatcgg aattaacgtc tccataccga tatttgcggg cggaggccat       960
     attgcgcaga gtatcgaagc ggcccaccgt aaagaacaat cccgcgagct gctgctggat      1020
     gctcagcgta aagcgctgga ggaagcggaa cgtgcctggt acgccattat cgctaatgac      1080
     gccaaaatac gtgccttgca aaaatcgatt gcttctgcaa agaaacggct cgaatcaacc      1140
     acgtatggaa aacaaatagg gcaaagaacc gttctggata tgctgaacgc tgaaagcgat      1200
     tactacaagt cattaaaaga actcgctaaa gcgcgatatg actatataac agcaaatatt      1260
     cagctcgcca aagctaccgg tgagctcgac tatgcctatc tcactaaatt cagttgctca      1320
     acataa                                                                 1326
//

If you have problems or comments...

PBIL Back to PBIL home page