(data stored in ACNUC8465 zone)

EMBL: FN543502.MUTT

FN543502.MUTT        Location/Qualifiers
FT   CDS_pept        126947..127345
FT                   /transl_table=11
FT                   /gene="mutT"
FT                   /locus_tag="ROD_01051"
FT                   /product="mutator protein
FT                   (7,8-dihydro-8-oxoguanine-triphosphatase)"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01051"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86885"
FT                   /db_xref="GOA:D2TGN6"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR003561"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGN6"
FT                   /protein_id="CBG86885.1"
FT                   /translation="MKTLQIAVGIIRNPQNEIFITRRAADAHMANKLEFPGGKIEAGET
FT                   PEQTLSRELQEEVGITPANATLFEKLEYQFPDRHITLWFWLVESWQGEPWGKEGQSGNW
FT                   IAADALSADDFPPANEPVIAKLKHASLA"
     atgaaaacac tgcaaatcgc cgtcggaatt atacgtaatc cgcagaatga aatttttatc        60
     acccgacgcg cggctgacgc gcatatggcg aacaagctgg agttcccggg ggggaaaatt       120
     gaggccggtg aaacgccgga gcagacgtta agtcgggagt tacaggaaga ggtcggcatt       180
     accccggcga atgccacgct gtttgaaaag ctggagtatc agtttccgga tcggcacatc       240
     accctgtggt tctggctggt cgaaagctgg caaggggagc cgtggggaaa agaggggcag       300
     tccggaaact ggattgccgc agacgcgctc agcgcggacg attttccgcc cgccaatgaa       360
     ccggtgattg cgaagctgaa acacgcttca ctggcctga                              399
//

If you have problems or comments...

PBIL Back to PBIL home page