(data stored in ACNUC8465 zone)

EMBL: FN543502.NUSB

FN543502.NUSB        Location/Qualifiers
FT   CDS_pept        518340..518759
FT                   /transl_table=11
FT                   /gene="nusB"
FT                   /locus_tag="ROD_04651"
FT                   /product="N utilization substance protein B"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_04651"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87244"
FT                   /db_xref="GOA:D2TL03"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR011605"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:D2TL03"
FT                   /protein_id="CBG87244.1"
FT                   /translation="MKPAARRRARECAVQALYSWQLSQNDIADVEYQFLAEQDVKDVDV
FT                   MYFRELLSGVATNSAYLDGLMKPYLSRLLEELGQVEKAVLRIALFELSKRSDVPYKVAI
FT                   NEAIELAKTFGAEDSHKFVNGVLDKAAPVIRPNKK"
     gtgaaacctg ctgctcgtcg ccgcgctcgt gagtgtgccg ttcaggcgct ctactcctgg        60
     cagttgtccc agaacgacat cgctgatgtt gaataccagt tcctggcgga acaggacgtc       120
     aaagacgttg acgtcatgta ctttcgcgaa ctgctgtccg gggtggcgac taacagcgcg       180
     tacctggacg gtctgatgaa accttacctg tctcgcctgc tggaagagct gggtcaggtg       240
     gagaaagcgg tcctgcgtat cgcgctgttt gagctgtcta aacgcagcga tgtgccttat       300
     aaagtggcca ttaacgaagc gatcgaactg gcgaaaacct ttggcgcgga agacagccat       360
     aagttcgtca atggcgtgct ggataaagca gcgcctgtga ttcgccccaa caaaaagtaa       420
//

If you have problems or comments...

PBIL Back to PBIL home page