(data stored in ACNUC8465 zone)

EMBL: FN543502.PE108

FN543502.PE108       Location/Qualifiers
FT   CDS_pept        complement(127445..127639)
FT                   /transl_table=11
FT                   /locus_tag="ROD_01061"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01061"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86886"
FT                   /db_xref="GOA:D2TGN7"
FT                   /db_xref="InterPro:IPR005584"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGN7"
FT                   /protein_id="CBG86886.1"
FT                   /translation="MSETITVNCPTCGKTVVWGEISPFRPFCSKRCQLIDLGEWAAEEK
FT                   RIPSSGDLSDSDDWSEEKE"
     atgtcagaaa ccattaccgt caactgcccg acctgcggca aaacggtcgt ctggggcgaa        60
     atcagtccgt ttcgcccgtt ttgcagtaaa cgctgccagc ttatcgatct gggtgaatgg       120
     gccgcagagg agaaacgtat tccgagcagc ggcgatttgt cagacagcga cgactggagt       180
     gaagagaaag agtaa                                                        195
//

If you have problems or comments...

PBIL Back to PBIL home page