(data stored in ACNUC8465 zone)

EMBL: FN543502.PE125

FN543502.PE125       Location/Qualifiers
FT   CDS_pept        complement(147571..148362)
FT                   /transl_table=11
FT                   /locus_tag="ROD_01231"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01231"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86903"
FT                   /db_xref="InterPro:IPR021556"
FT                   /db_xref="UniProtKB/TrEMBL:D2THC8"
FT                   /protein_id="CBG86903.1"
FT                   /translation="MKKMLFSALLLSLPLLSHAQQMFATPDEAASAFASAVASKNDAQL
FT                   TALLGDNWRQFLPPDGADPQAVARFNRDWKISHRIVRQGNVAYLNVGQQNWQLPIPVVK
FT                   SDTGWHFDMSAAQDEILTRTIGRNELSAIQAMRAYVDAQYDYRQRKQMFATKLISSEGQ
FT                   QDGLYWPVQPGERPSPLGPAFSPDMHSEGYHGYHFRIIASNSSRGFALLAWPVTWGETG
FT                   VMSFVVNQDDKVYQADLGKETEKKAAAITQYSDQQPWQPVE"
     atgaaaaaaa tgctatttag cgccctgctg ctttcgctgc ctttactgag ccacgcgcag        60
     cagatgttcg ccacgccgga tgaagcggcc agcgccttcg ccagcgcggt cgccagcaaa       120
     aacgatgcgc agttaaccgc gctgttaggg gataactggc gacaattttt gcctcccgac       180
     ggcgccgacc cgcaagcggt cgcgcggttt aaccgcgact ggaaaatcag ccatcgcatt       240
     gtgcggcagg gcaatgtcgc atacctgaac gtcgggcagc aaaactggca gttgcccatt       300
     cctgtcgtga agtcagatac gggctggcat tttgatatgt ccgccgcgca ggatgaaatc       360
     ctgacgcgaa ccattggccg caacgagctg tcggcaatac aggccatgcg cgcctacgtc       420
     gacgcccagt atgattaccg gcagcgtaaa cagatgttcg caacaaagct gatcagcagc       480
     gaggggcaac aggacggact ctactggccg gtgcagcccg gtgaacggcc cagcccgtta       540
     ggcccggcgt tcagtccgga tatgcatagc gaaggctatc acggctacca tttccgcata       600
     attgccagca acagcagccg cgggttcgcg ttactggcct ggccggtgac atggggcgaa       660
     acgggggtga tgagcttcgt ggtgaatcag gacgataagg tgtatcaggc ggacctggga       720
     aaagagacgg agaagaaagc cgccgcaatc acgcagtaca gcgaccagca accgtggcag       780
     cctgtagaat ag                                                           792
//

If you have problems or comments...

PBIL Back to PBIL home page