(data stored in ACNUC8465 zone)

EMBL: FN543502.PE199

FN543502.PE199       Location/Qualifiers
FT   CDS_pept        complement(233909..234127)
FT                   /transl_table=11
FT                   /locus_tag="ROD_01982"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01982"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86977"
FT                   /db_xref="InterPro:IPR009624"
FT                   /db_xref="UniProtKB/TrEMBL:D2TI80"
FT                   /protein_id="CBG86977.1"
FT                   /translation="MLTGGHVEKYCELIRKRYAEIASGDLGYVPDALGCVLKVLNEMAA
FT                   DSALSESVREKAAYAAANLLVSDYVNE"
     atgctgacag gagggcatgt ggaaaaatat tgtgagttaa tacgcaaacg gtatgcggaa        60
     attgccagcg gagacttagg gtatgtcccg gatgcgctgg gttgcgtatt gaaggtgctt       120
     aatgaaatgg ccgcggatag cgccctttca gagtcggtca gggaaaaggc ggcgtacgct       180
     gctgcgaact tactggtgag cgattatgtc aatgaatga                              219
//

If you have problems or comments...

PBIL Back to PBIL home page