(data stored in ACNUC8465 zone)

EMBL: FN543502.PE203

FN543502.PE203       Location/Qualifiers
FT   CDS_pept        236570..237907
FT                   /transl_table=11
FT                   /locus_tag="ROD_02011"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02011"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86981"
FT                   /db_xref="UniProtKB/TrEMBL:D2TI84"
FT                   /protein_id="CBG86981.1"
FT                   /translation="MNKKLIALAILFAMGSAHACENTEDCKAAVDDVYEAINTKMQPKQ
FT                   ENESAAVWGEKYANWLGRVNEVAERRLGTTFDNLGDIARWEIANSKTGSSANADSGENG
FT                   NTGATDTNTKNPTGDFIEPELETAYVTAGQAQAGDRAAIAQAQDYADSVATEVENKTKD
FT                   YAAQVATETAATAANNAIGLAAQVATETAATAENNAKGYAANVATAAESKAKQYATSVA
FT                   TDAASTAQTNAEGYAAQVATETAATAENNAKGYASQIATKAADSAKNAAETHADKAATE
FT                   AKSAAVKEAKDDARAQVTAAEKRSNAHADATAKKAEVNANDYTDQQMATAEEYATTLAH
FT                   STIRYANQSLQESKSYTDRVARGLQKQINHNGKAIKRLGASAQATANLHYNANHNGYAI
FT                   AVGEYNSETALAGGLQFNTGKSTAVTVQGSYDAESFGGSVGLHGDW"
     atgaataaaa agttaatagc tttagcaatt ctgtttgcta tgggtagtgc tcacgcttgc        60
     gaaaataccg aagattgcaa agcggcagtc gatgatgttt acgaagcaat taatacgaaa       120
     atgcagccga agcaggaaaa tgagagcgcg gcggtatggg gcgagaagta tgcgaactgg       180
     ctcgggcggg ttaacgaagt tgccgaacgt cgtttaggca cgaccttcga caatcttggc       240
     gatattgccc gctgggagat cgccaacagt aagaccggaa gttcagctaa cgccgattca       300
     ggcgagaacg gtaatacggg cgctacggat acaaatacaa aaaatcctac aggcgacttt       360
     attgagccgg aactggagac ggcttatgtt actgcgggcc aggcgcaggc aggcgaccgc       420
     gcggcaattg cgcaagcgca ggattatgcg gatagcgtcg cgactgaggt cgagaataaa       480
     acaaaggatt acgcggccca ggttgcgact gaaaccgccg cgacggcggc gaataatgcg       540
     ataggcctcg ccgctcaggt tgccaccgaa accgcggcaa cggcggagaa caacgcgaaa       600
     ggctatgccg caaacgtggc cactgctgcg gaaagtaaag cgaaacaata cgccacaagc       660
     gtggctacgg acgcagcgtc aacggcgcag accaacgccg aaggttacgc cgcccaggtt       720
     gccactgaaa ccgcagcgac ggcggagaac aatgccaaag gctatgcctc gcagatcgcc       780
     accaaagcgg cggacagcgc aaaaaacgcc gcagaaaccc acgctgataa agccgctacc       840
     gaggcgaaaa gcgcagcggt aaaagaggcg aaagacgacg ccagagcgca agtaacggca       900
     gcggagaagc gttcgaacgc gcatgctgac gctacggcaa agaaagcgga agtgaatgcg       960
     aatgactata ccgaccaaca aatggcaacg gcggaagagt acgccaccac cctggcgcat      1020
     tccaccatcc gctacgctaa tcagagctta caggagtcaa agagctatac cgatcgcgtt      1080
     gccaggggct tacagaagca gataaaccac aacggcaaag cgattaagcg tctgggcgcc      1140
     agcgctcagg cgacagcgaa cctccactac aacgccaatc ataacggcta tgctattgcg      1200
     gttggcgagt acaacagcga aaccgcgctc gcgggcggcc tgcagttcaa taccggtaag      1260
     agcactgccg taacggtaca gggcagctat gatgccgaat cgttcggcgg tagcgtcggt      1320
     ctgcacgggg actggtaa                                                    1338
//

If you have problems or comments...

PBIL Back to PBIL home page