(data stored in ACNUC8465 zone)

EMBL: FN543502.PE22

FN543502.PE22        Location/Qualifiers
FT   CDS_pept        26543..26671
FT                   /transl_table=11
FT                   /locus_tag="ROD_00201"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00201"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86800"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGI5"
FT                   /protein_id="CBG86800.1"
FT                   /translation="MQVTFLRTMKGKFFQNKTKLFSGTPRSAEEGAGSRKKKAAEV"
     atgcaggtca cgtttttgcg cacaatgaaa ggtaaattct ttcagaacaa aacaaaatta        60
     ttttcaggaa ctccgcgcag cgcagaagaa ggagcaggga gcagaaagaa gaaagcggcg       120
     gaggtgtga                                                               129
//

If you have problems or comments...

PBIL Back to PBIL home page