(data stored in ACNUC8465 zone)

EMBL: FN543502.PE244

FN543502.PE244       Location/Qualifiers
FT   CDS_pept        complement(289443..290015)
FT                   /transl_table=11
FT                   /locus_tag="ROD_02431"
FT                   /product="hypothetical prophage protein"
FT                   /note="similar to Mu protein gp48"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02431"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87022"
FT                   /db_xref="InterPro:IPR018755"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ19"
FT                   /protein_id="CBG87022.1"
FT                   /translation="MNMVDLFRAMLPPVSYDQNGKYISAELMAEANVMEAVKASAARVL
FT                   AQITPLQASMTLSDWERVYGVVPREGATQQERRQNILVKMAATGGLSIPYFKSLAASLG
FT                   YTITITEPRAFRVGINRCGDRLLIPEIRWVWQVNVIGTKTPVYRFRTGASATGEPLTAF
FT                   GESILENTFKDLKPAFTDCYFTYEVEE"
     atgaatatgg tcgatttatt tcgcgccatg ctgccgcctg tcagttatga ccagaacgga        60
     aaatatattt ccgcagaact gatggccgag gctaacgtca tggaggccgt gaaggcctca       120
     gcggcgcgcg ttctggcaca aatcaccccg ttgcaggcat cgatgacgct gtccgactgg       180
     gagcgcgtgt acggtgttgt cccccgtgaa ggggcaacac aacaggagcg gcggcagaac       240
     attctggtaa aaatggctgc cactggcggg ctgtcaattc cttactttaa gagtcttgcc       300
     gccagcctgg gctacaccat caccattacg gagccgcgag cgttccgggt ggggataaat       360
     cgctgcggtg accgtctgct gataccggaa atccgctggg tgtggcaggt caatgttatc       420
     gggacaaaaa cgccggtcta ccgtttcaga acgggggcat cggcaaccgg cgaaccgctg       480
     acggcctttg gtgaatccat tttagaaaac acgtttaaag atcttaaacc ggcttttaca       540
     gactgttatt tcacatatga ggtggaggaa taa                                    573
//

If you have problems or comments...

PBIL Back to PBIL home page