(data stored in ACNUC8465 zone)

EMBL: FN543502.PE261

FN543502.PE261       Location/Qualifiers
FT   CDS_pept        complement(303606..304157)
FT                   /transl_table=11
FT                   /locus_tag="ROD_02591"
FT                   /product="hypothetical prophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02591"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87039"
FT                   /db_xref="InterPro:IPR006522"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ36"
FT                   /protein_id="CBG87039.1"
FT                   /translation="MSTGKLDIKIDLSAYNTTLGKLIRSVKDRRDLMTALAGSMLDAVE
FT                   TNLEQQGRPKWMGWSPAYAKRRGPGQILQKSGRLAASIRSAVNNNEATVGTNVRYARIH
FT                   NEGGEIRHQARTQNLYFKQYKNGSVSTRFVKKRNSNFVQSATVGAYTVNMPARPFLQLV
FT                   QDDIDELENTANRYFARVID"
     atgagcaccg gtaaactgga tattaagatt gatttaagcg cgtataacac cacgctgggg        60
     aaactgattc gttccgtgaa ggaccggcgc gacctgatga cggcgcttgc gggttccatg       120
     ctggatgcgg ttgagactaa cctggaacaa cagggtcgcc cgaaatggat gggctggagt       180
     ccggcttatg cgaagcgacg cggccccggg caaatccttc agaagtccgg gcgactggct       240
     gccagtatcc gctctgcggt taacaataac gaggccacgg tcgggacaaa cgtccgttac       300
     gcccgtatcc acaacgaagg cggcgaaatc cgccatcagg cacggacgca gaacctgtat       360
     tttaaacagt acaaaaacgg cagcgtcagc acccgctttg tgaaaaagcg caacagtaat       420
     tttgtgcaga gcgcaacggt cggagcgtat acggtcaaca tgcccgcgcg tcccttcctt       480
     cagcttgtgc aggacgacat cgacgagctg gagaacaccg caaaccgcta ttttgcgcgt       540
     gtgattgact ga                                                           552
//

If you have problems or comments...

PBIL Back to PBIL home page