(data stored in ACNUC8465 zone)

EMBL: FN543502.PE264

FN543502.PE264       Location/Qualifiers
FT   CDS_pept        complement(306902..308542)
FT                   /transl_table=11
FT                   /locus_tag="ROD_02621"
FT                   /product="hypothetical prophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02621"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87042"
FT                   /db_xref="InterPro:IPR006517"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ39"
FT                   /protein_id="CBG87042.1"
FT                   /translation="MAKRKLSIKEFQRSLQEYIANLRQTIEAECLGFDVNPQATQARRA
FT                   AVCDPVTGYDYFVENYFPHYVRNPAKSELHKYLFSRLPQVVASPAPENDAIAAPRGEAK
FT                   STLVTQLFTLWTIIRAIKHYPVIIMDSIDQAYPMLEAIKAELEFNPRLKNDFPEVCGQG
FT                   RVWRMGTIVTANNIKVTVAGSGKKLRGLRHGPYRPDLIILDDIENDEMVRNPEQRDKLH
FT                   DWLTKTVMPLGEAGGKTDIIYIGTILHYDSVLSRTLNNPMWKTARFKAVIQWPANMKLW
FT                   DEWEELIRNKQPEAAEALYRQNEAEMLAGSVVSWAARPLLALMKIRVRDGHDTFDSEYQ
FT                   NDPVSGEDALFAGCIKFWVNRLDEWVFYGAVDPSLGKKNKNRDPSAILVGGFNRFTGIL
FT                   DVVEADIRRRLPNKLIEDVIKYQREYHCLCWSFESVQFQEFLRTVLVERSAALGVPVPA
FT                   LPVIPLEDKALRIESLQPHMANGLIRISHTHQTLIDQLRHYPKADHDDGPDCLHMLWTL
FT                   AVSRSAKFQIHTPRSTGRDRGGRFGSGGW"
     gtggcaaaac gtaaactttc cattaaagag tttcagagaa gcctgcagga gtacatcgcc        60
     aacctccgcc agaccatcga ggctgaatgt ctggggttcg atgtaaaccc gcaggccaca       120
     caggcccgcc gggcggcagt ctgcgacccg gtgacgggct acgattattt tgtcgaaaac       180
     tatttcccgc attacgtccg caacccggca aaaagtgagc tgcataaata cctgttcagc       240
     cgtctgccac aggttgtggc aagcccggcc ccggagaacg acgccatcgc cgcgcctcgt       300
     ggtgaggcaa aatccacgct ggtgactcag ctgtttaccc tgtggaccat tatccgggcc       360
     attaagcatt acccggtcat cattatggac agtatcgacc aggcttatcc gatgctggaa       420
     gccatcaagg ctgaactgga atttaacccc cgtttaaaaa acgatttccc ggaagtgtgc       480
     gggcaggggc gcgtctggcg tatggggacc atcgtcacgg ccaacaatat caaggtgacc       540
     gttgccggta gtggtaaaaa actgcgtggt ctgcgccacg gcccgtaccg tcctgacctg       600
     atcatcctcg acgacatcga gaacgacgag atggtgcgta acccggagca gcgcgacaag       660
     ctgcacgact ggctcaccaa aaccgtgatg ccgctgggtg aggctggcgg taaaaccgat       720
     attatttata tcggaaccat cctgcattac gactccgtgc tgtcgcgcac actgaataac       780
     ccgatgtgga aaacggcccg ttttaaggct gtcattcagt ggcctgccaa catgaagctg       840
     tgggacgagt gggaagaact catccgcaac aaacagccgg aagcggcgga ggcactttac       900
     cggcagaacg aagccgagat gctcgccggg tcggtggtgt catgggcggc gcgtcccctg       960
     ctggcgctga tgaaaatccg tgttcgtgac ggtcatgaca cctttgattc tgaataccag      1020
     aacgacccgg tcagcggtga agatgcgctg tttgcgggct gcattaagtt ctgggttaac      1080
     cgtcttgatg aatgggtgtt ttatggtgct gttgacccca gtctcgggaa gaaaaacaaa      1140
     aaccgcgacc cgtcggccat tctcgtgggg ggctttaacc gctttaccgg cattctggat      1200
     gtggttgaag ccgatatccg ccgacgtctg ccaaacaaac ttatcgaaga cgtgattaag      1260
     tatcagcggg aataccactg tctgtgctgg tcgtttgagt ccgtccagtt tcaggagttt      1320
     ctgcgtaccg tgctggttga gcgttcggcg gcgctgggtg tgccggttcc ggcgctgccg      1380
     gtcatcccgc tggaggataa ggcactgcgt atcgagtccc ttcagccgca tatggccaac      1440
     ggcctgattc gtatcagtca cacacatcag acactgattg accagctgcg ccactacccc      1500
     aaagctgacc acgatgatgg cccggactgt ctgcacatgc tgtggacgct ggcggtttcg      1560
     cgtagcgcaa aatttcagat tcacacccca cgcagcaccg ggcgtgaccg tggcgggcgt      1620
     tttggttcag gaggatggta a                                                1641
//

If you have problems or comments...

PBIL Back to PBIL home page