(data stored in ACNUC8465 zone)

EMBL: FN543502.PE271

FN543502.PE271       Location/Qualifiers
FT   CDS_pept        complement(311166..311558)
FT                   /transl_table=11
FT                   /locus_tag="ROD_02691"
FT                   /product="putative prophage membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02691"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87049"
FT                   /db_xref="GOA:D2TJ46"
FT                   /db_xref="InterPro:IPR032637"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ46"
FT                   /protein_id="CBG87049.1"
FT                   /translation="MSEPLSGGGAVAVTIGGASVFGLLTNTDFGVVVGAFAGALFVVTQ
FT                   QKEIPVWRMAIHLLVAFVVGVLGAGVAASLMQWLTHYNDKPLDALCAVGVSALSIKILT
FT                   FLYQQEISSLFGLFSRLRGGGGGNGK"
     atgtctgaac ccttatcagg cggcggagct gtggcagtca ccatcggtgg tgccagtgtg        60
     tttggccttc tcaccaatac cgatttcggg gtcgtggtgg gcgcgtttgc cggggcgctt       120
     tttgttgtca ctcagcagaa agaaatcccg gtatggcgaa tggctattca cctgctcgtc       180
     gcgtttgtgg ttggcgttct gggggctggc gtggctgcgt cactgatgca gtggctgacc       240
     cactataacg acaaaccgct cgatgcattg tgtgcggtcg gtgtctctgc tttatccatc       300
     aagatactga cttttcttta tcaacaggaa atttcatcgc tgttcggcct gttttccaga       360
     ctgcgcggcg gagggggtgg aaatggaaag tag                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page