(data stored in ACNUC8465 zone)

EMBL: FN543502.PE272

FN543502.PE272       Location/Qualifiers
FT   CDS_pept        complement(311741..312046)
FT                   /transl_table=11
FT                   /locus_tag="ROD_02701"
FT                   /product="hypothetical prophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02701"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87050"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ47"
FT                   /protein_id="CBG87050.1"
FT                   /translation="MGLRKKETLMTNYTALGEYTAYSEQARDAAGRRFAYMKNLASQLN
FT                   RMAEQPDMVVQEEALQCAIADIIASENEMRAALEKANASAPLCNKPLITPDSLSRF"
     atgggcctca gaaaaaagga gacacttatg accaactata cggcacttgg cgagtatacg        60
     gcctactcag agcaggcccg ggatgctgcc ggacgccgct tcgcttatat gaaaaatctg       120
     gccagccagc taaaccgaat ggccgaacaa ccggatatgg ttgttcagga agaagcgttg       180
     cagtgtgcta ttgctgacat catcgccagc gaaaacgaga tgcgcgccgc tctggaaaaa       240
     gcaaacgcct ctgctccgct ttgcaataaa cctcttatta cgccggattc cctttcccgc       300
     ttctga                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page