(data stored in ACNUC8465 zone)

EMBL: FN543502.PE283

FN543502.PE283       Location/Qualifiers
FT   CDS_pept        complement(316144..316434)
FT                   /transl_table=11
FT                   /locus_tag="ROD_02781"
FT                   /product="putative prophage membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02781"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87061"
FT                   /db_xref="GOA:D2TJ57"
FT                   /db_xref="InterPro:IPR031858"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ57"
FT                   /protein_id="CBG87061.1"
FT                   /translation="MVIDKTITIDVAMNTGLALIGYGYITFMSFRWLISSVFKQCERRR
FT                   CKDKRVKALNAFNDAFDIDRMQQGDPARVITRGDVVILVYRSEKNEQEAAQ"
     atggtcattg ataaaacgat aacgatagat gtagccatga atacaggtct ggcgcttatt        60
     ggttatggct atatcacttt tatgtcattc aggtggttga tttcttcggt ctttaaacaa       120
     tgtgaaagac gtcgctgcaa agacaagcgc gtgaaggcac tgaatgcgtt taatgacgct       180
     tttgatattg accgtatgca acagggcgac ccggcacgcg taattacccg gggagatgtc       240
     gtgattttgg tataccggag tgaaaaaaat gagcaggagg cggcgcagtg a                291
//

If you have problems or comments...

PBIL Back to PBIL home page