(data stored in ACNUC8465 zone)

EMBL: FN543502.PE291

FN543502.PE291       Location/Qualifiers
FT   CDS_pept        complement(319733..319966)
FT                   /transl_table=11
FT                   /locus_tag="ROD_02851"
FT                   /product="hypothetical prophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02851"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87069"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ64"
FT                   /protein_id="CBG87069.1"
FT                   /translation="MHQDIKEYRAGNSCAAYSLGASRAEQRGDYAEAEKLWRKAAQSPC
FT                   STLRRIWAEHRAEFCANAHLKGWRPRHECEEL"
     atgcatcagg atatcaaaga gtacagagcc ggaaatagtt gcgcggcgta ttcgctgggc        60
     gcgtccagag cagaacaacg cggcgattat gctgaggctg aaaaactgtg gcgtaaggca       120
     gcgcaaagcc cgtgtagcac cctgcgccgc atctgggctg aacatcgtgc ggagttctgc       180
     gctaacgctc acctgaaggg ctggaggcca cgccatgaat gcgaagaact ttaa             234
//

If you have problems or comments...

PBIL Back to PBIL home page