(data stored in ACNUC8465 zone)

EMBL: FN543502.PE295

FN543502.PE295       Location/Qualifiers
FT   CDS_pept        complement(321054..321320)
FT                   /transl_table=11
FT                   /locus_tag="ROD_02891"
FT                   /product="hypothetical prophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02891"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87073"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ68"
FT                   /protein_id="CBG87073.1"
FT                   /translation="MQRRNVNSLMENKTMDKQTINAVRSRARVAIHTTGGRVTGQHHRL
FT                   PVVYACPPVGGPVWPVTEIIQTFSGLRRVVKTSCIDGCTVVWQ"
     atgcagcgca gaaatgttaa ttcactgatg gagaacaaga cgatggacaa gcagaccatt        60
     aacgccgtcc gttcccgtgc ccgtgtggcc atccacacca ccggcggtcg tgtaacgggg       120
     cagcatcacc gtttacctgt ggtttatgcc tgcccacctg tgggtggtcc tgtatggccg       180
     gtaacggaaa tcatccagac attcagcggc ctgcgccgcg tggtgaaaac gtcctgtatc       240
     gacggctgca ccgtcgtatg gcagtaa                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page