(data stored in ACNUC8465 zone)

EMBL: FN543502.PE296

FN543502.PE296       Location/Qualifiers
FT   CDS_pept        complement(321320..321670)
FT                   /transl_table=11
FT                   /locus_tag="ROD_02901"
FT                   /product="hypothetical prophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02901"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87074"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ69"
FT                   /protein_id="CBG87074.1"
FT                   /translation="MTGVLRMEKMALRNEIRALQSIGRNGCVYSNGTPGEIIPFVDCFV
FT                   PGELRIDLYSREREINGTGNTSDDWDVDECCARLMIIPFEQTLQGFRRAYRLARMCARL
FT                   PRYQSRLAFALR"
     gtgactggag ttttgcgcat ggaaaaaatg gctctcagaa atgaaataag ggcactacag        60
     agtattggtc gtaatggttg tgtttattct aatggaaccc ctggtgaaat tattccgttt       120
     gttgattgct tcgtgccggg tgaactgcgc attgatttgt attcccgtga acgggaaatc       180
     aatggaaccg gaaataccag cgacgactgg gatgttgatg aatgctgtgc gcgattaatg       240
     attattcctt ttgagcagac tttacagggg tttcgtcggg cttatcgtct tgcgcgtatg       300
     tgtgcccgtc ttccccgtta tcagtcacga cttgcgtttg cactcagata a                351
//

If you have problems or comments...

PBIL Back to PBIL home page