(data stored in ACNUC8465 zone)

EMBL: FN543502.PE30

FN543502.PE30        Location/Qualifiers
FT   CDS_pept        33775..34557
FT                   /transl_table=11
FT                   /locus_tag="ROD_00271"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00271"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86808"
FT                   /db_xref="GOA:D2TGK8"
FT                   /db_xref="InterPro:IPR010551"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGK8"
FT                   /protein_id="CBG86808.1"
FT                   /translation="MADALHSFGLDMAVHHHPPGFSYGDEVTGPMPEIRRLDQIRASLR
FT                   DPHCSGPQEVYAIAMDVARMQDRDELRKRMLLFGVVTYAAGRLGEEPVRSQGHVHRISQ
FT                   HSGWSPPELYEIWQGKAIVYMQEHVGDDPGRCFAVIAGPGEKVLVPPGWGHATISADPD
FT                   APLTFGAWCDREYGFEYEAIRARKGLAWYPLLQDKNVVWQHNPRYLPGRLQVVTPRQYT
FT                   EFAITSAPVYQQFIDDPARFQFISRPDKVAELWAHFHP"
     atggctgacg cacttcactc tttcggtctg gatatggcgg tgcatcatca tccgcccggc        60
     tttagctatg gcgatgaggt caccgggccg atgccggaaa ttcgccgact cgaccagatt       120
     cgtgcttcgc tgcgcgaccc gcattgcagc gggccgcagg aggtctatgc catcgcgatg       180
     gatgtcgcca ggatgcagga tcgcgacgag ctgagaaagc gtatgctgtt atttggcgtg       240
     gtgacctacg cggcagggcg gctgggtgaa gagccggtac gtagccaggg gcatgtccat       300
     cgcatcagcc agcacagcgg ctggtcgccg ccggagctgt atgagatctg gcagggaaaa       360
     gcgatcgtct atatgcagga gcatgtcgga gacgatccgg gacgctgttt cgcggtgatt       420
     gccggtcccg gcgagaaggt gctggtgccg ccgggctggg gacacgccac tatctccgcc       480
     gatcctgacg cgccattaac ctttggcgcg tggtgcgatc gcgaatacgg ctttgagtat       540
     gaggcgataa gagcgcgcaa aggcctggcc tggtatccgc tgttgcagga taaaaacgtg       600
     gtctggcagc ataacccgcg ctatcttccg ggtcgcctgc aggtcgtgac gccccggcaa       660
     tatacggagt ttgccatcac ttccgccccg gtataccagc agtttattga cgatcccgcc       720
     cgtttccagt ttatttcccg tccggataaa gttgcggagc tgtgggctca ctttcatcca       780
     taa                                                                     783
//

If you have problems or comments...

PBIL Back to PBIL home page