(data stored in ACNUC8465 zone)

EMBL: FN543502.PE356

FN543502.PE356       Location/Qualifiers
FT   CDS_pept        382975..383904
FT                   /transl_table=11
FT                   /locus_tag="ROD_03521"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03521"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87134"
FT                   /db_xref="GOA:D2TK04"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D2TK04"
FT                   /protein_id="CBG87134.1"
FT                   /translation="MINIDLRGLTPAPVTPFTRDGRVDYDAIQRLGNWLGSIDGVKGLV
FT                   VLGHAGEGTFLTQEEQANVIRAFVKSVDDKLPIIAGITGEGTEVAALEAKRAVAAGASA
FT                   GLLYPSHGWLRFGYQDGAPQDRYRVVYEESGLPLILFQYPDVTKATYNLKTLLDISAQP
FT                   GVFAMKNGVRNMRRWDTEIPVIRCERPDLQILSCHDEYLLHTAFDVDGFLVGYGNIAPE
FT                   PLIEMIKAGKAGDYVKARQLHDRLLPVTKSVYHRGSHMEGTVALKHALVARGILEHATV
FT                   RSPLLPLEKGAEKEIHDAMRAAELGRVR"
     atgattaaca tcgatctgag aggtttgact ccggctccgg ttacgccatt cactcgcgat        60
     ggacgtgtag actatgatgc cattcagcgc ctcggtaact ggctgggcag cattgacggc       120
     gtgaaaggtc tggtagtgct gggacacgcg ggagaaggga cttttctgac ccaggaagag       180
     caggcgaatg tgatccgcgc gtttgtgaaa tccgtggatg ataagcttcc cattattgcc       240
     ggtatcaccg gggaagggac ggaagtggcc gcgctggagg cgaagcgcgc cgttgccgcc       300
     ggcgcatctg cgggtttgct ctatccttca cacggctggc tgcgttttgg ctatcaggac       360
     ggcgcgcctc aggatcgcta ccgcgtggtg tatgaagaaa gtggcttgcc gctgattctt       420
     ttccagtatc cggatgtcac taaagccacc tacaacctga aaacgctgct ggatatctcc       480
     gcgcagccgg gcgtatttgc catgaagaat ggcgtgcgta atatgcgccg ctgggacact       540
     gagattccgg ttattcgctg cgagcgtccg gatctgcaaa tcttaagctg ccacgatgaa       600
     tatctgctgc atactgcctt tgatgtggat ggtttccttg tcggctacgg taatatcgcg       660
     cctgagccgt taattgaaat gatcaaggcg ggtaaagcgg gcgattatgt taaagcgcgt       720
     cagctgcacg atcgtctgct gccggtgacc aaaagcgtgt accaccgcgg ttctcacatg       780
     gaagggacag tggcccttaa acatgctctg gttgcgcgtg ggatccttga acatgcgacc       840
     gttcgctctc cgctgctgcc gttggaaaag ggcgctgaaa aagagatcca cgatgccatg       900
     cgcgccgctg agctgggccg cgtccgttaa                                        930
//

If you have problems or comments...

PBIL Back to PBIL home page