(data stored in ACNUC8465 zone)

EMBL: FN543502.PE357

FN543502.PE357       Location/Qualifiers
FT   CDS_pept        383956..384216
FT                   /transl_table=11
FT                   /locus_tag="ROD_03531"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03531"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87135"
FT                   /db_xref="GOA:D2TK05"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:D2TK05"
FT                   /protein_id="CBG87135.1"
FT                   /translation="MRIIGYFARLSFAVLHHNVGAFTSVSSLGDVILTGTPGGIGKKRT
FT                   PPLFMQPGDRVEVEIEHIGCLINTVCSDELSFTGRLHPKIW"
     ttgcggataa taggttactt cgcccggcta tcttttgctg ttcttcatca taacgtcggg        60
     gctttcacct ctgtctcttc cctgggtgat gtgatcctga ccggcacccc cggaggtatc       120
     ggaaaaaaac gtacgccgcc gctctttatg cagcccgggg acagggtgga agttgagatt       180
     gagcatatcg gatgtctgat taataccgtg tgcagcgatg aattgtcgtt taccggcagg       240
     ttacatccaa agatatggtg a                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page