(data stored in ACNUC8465 zone)

EMBL: FN543502.PE371

FN543502.PE371       Location/Qualifiers
FT   CDS_pept        complement(402955..403491)
FT                   /transl_table=11
FT                   /locus_tag="ROD_03671"
FT                   /product="putative major fimbrial subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03671"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87149"
FT                   /db_xref="GOA:D2TK19"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="InterPro:IPR039458"
FT                   /db_xref="UniProtKB/TrEMBL:D2TK19"
FT                   /protein_id="CBG87149.1"
FT                   /translation="MKKVLLSSLVVLALGSTSAMAIDGTITINGKLTNATCKVTVDKST
FT                   TGDATVTLPTLSVAKLAVAEATAGATNFTMKLTGCSGASKVRAFFEAGADVDASTGRLN
FT                   NSSESSEVAKNVQIQLRDEADNILAAGNTSQRSNAATPLASGAANLNYSARYYATAAAE
FT                   AGDVQSSVTYSIDYE"
     atgaaaaaag tacttctttc ctcgttggtt gttctggctc tgggttccac ttccgctatg        60
     gctattgacg gtactattac catcaacggc aagctgacga atgcaacctg taaagttacg       120
     gttgataaaa gcaccaccgg tgacgccacc gttacgctgc cgacgctgtc tgtagccaag       180
     ctggccgttg ctgaagccac cgcgggcgca accaacttca ccatgaagct gaccggctgc       240
     tcgggcgcca gtaaagtgcg tgcattcttt gaagctggcg cagatgttga tgccagcacg       300
     ggtcgtctga ataactcctc ggagagttct gaggttgcca agaatgtcca gatccagctg       360
     cgtgatgaag ctgataacat cctggcagca ggtaatacca gccagcgtag taacgctgcc       420
     actccgctgg cttctggcgc cgctaacctg aactattcag cgcgttacta cgcaacggcc       480
     gcagctgaag cgggtgacgt acagagctct gtgacttact cgatcgacta cgagtaa          537
//

If you have problems or comments...

PBIL Back to PBIL home page