(data stored in ACNUC8465 zone)

EMBL: FN543502.PE378

FN543502.PE378       Location/Qualifiers
FT   CDS_pept        complement(410678..410809)
FT                   /transl_table=11
FT                   /locus_tag="ROD_03741"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03741"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87156"
FT                   /db_xref="UniProtKB/TrEMBL:D2TK26"
FT                   /protein_id="CBG87156.1"
FT                   /translation="MLVNAQVISFVTSGLSPQQLSTFTGASSKFSLSNVIQAAANAS"
     atgttagtca acgctcaagt aatctctttc gtcaccagcg gccttagccc gcaacaacta        60
     tccactttta cgggtgcgag cagcaaattc tcgttgagta atgtgataca ggcggcagcg       120
     aatgcttctt aa                                                           132
//

If you have problems or comments...

PBIL Back to PBIL home page