(data stored in ACNUC8465 zone)

EMBL: FN543502.PE389

FN543502.PE389       Location/Qualifiers
FT   CDS_pept        complement(421419..423617)
FT                   /transl_table=11
FT                   /locus_tag="ROD_03851"
FT                   /product="putative xanthine
FT                   dehydrogenase,molybdenum-binding subunit"
FT                   /EC_number="1.17.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03851"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87167"
FT                   /db_xref="GOA:D2TK37"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:D2TK37"
FT                   /protein_id="CBG87167.1"
FT                   /translation="MKFEEPAGTNPIDQMKVVGRPHDRIDGPRKTTGTAPYAYEWHDIA
FT                   PDATYGYIVDSAIAKGRIVSMNIQPALNAPGVLAVVTAENAGPLGKGERNAATLLGGPE
FT                   IEHYQQAVALVVAETFEQARAAASLVQVEYQREPGAYDLAQEKPSVTTPPEDQPDQNVG
FT                   DFASAWAAAEVKLDAIYTTPDQSHMAMEPHASMAIQEGDKLTLWTSNQMINWARTDLAA
FT                   TLKMPEENIRVISPYIGGGFGGKLFLRSDALLSALGARAVNRPVKVMVPRPVIPNNTTH
FT                   RPATIQHIRIGTDREGRITAIAHDSWSGNLPGGSPETAVNQSKFLYAGANRHTGLRLAH
FT                   LDLPEGNSMRAPGETPGLMALEIAIDEMAIRAGVDPVEFRILNDTQVDPANPERPFSRR
FT                   QLIECLRTGAERFGWQHRHATPGQVRDGNWLIGMGMAAGYRDNVVVPSGARVQFHANGT
FT                   LTVETDMTDIGTGSYTIIAQTAAEMLGLPLEKVEVRLGDSAFPVSAGSGGQWGANTSTA
FT                   GVYAACVKLRETIAATLGFDPATATFAEEKIHADGRSVALREAAANGTLSAEDTIEFGD
FT                   LAKKYQQSTFAGHFVEVGVDVATGEIRVRRMLAVCAAGRILNPKTARSQVIGAMTMGIG
FT                   AALMEELAVDTRQGYFVNHDLAAYEVPVHADIPQQEVIFLEDTDPISSPMKAKGVGELG
FT                   LCGVSAAIANAVYNATGVRVRDYPIRLDKLLSALPDAV"
     atgaaatttg aagaaccggc aggcaccaac cccatcgacc agatgaaggt ggtaggacgt        60
     ccgcacgatc gcatcgacgg gccgcgtaaa accaccggca ccgcgcctta tgcgtatgaa       120
     tggcacgata ttgcccccga cgcgacgtac ggctatatcg tggattccgc gattgcaaag       180
     gggcggattg tctccatgaa catccagccc gcgctgaacg cgccgggggt gctggccgta       240
     gtgaccgctg agaatgccgg gccactcggc aaaggcgaac gcaacgccgc cacgctgctg       300
     ggcggtccgg aaatcgaaca ttaccagcag gccgtcgcgt tagtggtggc ggaaaccttc       360
     gaacaggcgc gcgcggcggc ctctctggta caggtggagt accagcgcga gccgggcgcg       420
     tacgatctgg cgcaagagaa gccgtcagtc accaccccgc cggaggatca gccggatcag       480
     aacgtcggcg atttcgccag cgcatgggcg gcggcggaag tgaagctcga cgccatctac       540
     accacgcccg atcagagcca tatggcgatg gagcctcatg cctcaatggc tatccaggaa       600
     ggcgataagc tgactctctg gacctcaaac cagatgatta actgggcgcg aaccgatctt       660
     gccgccacgc tgaagatgcc ggaagagaat atccgcgtga tatcgcccta tatcggcggc       720
     ggcttcggcg gcaaactgtt tctgcgcagc gacgcgctgc tgtcggcgct gggcgcccgg       780
     gcggtcaatc gcccggtgaa agtgatggtg ccgcgtccgg tcattcctaa caataccact       840
     caccgtccgg cgaccattca gcatattcgc atcggcaccg accgcgaggg caggatcacc       900
     gctatcgccc atgacagctg gtccggaaat ttgccgggcg gctcgccgga gacggcggta       960
     aaccagagta aattccttta cgctggcgcg aaccgccaca ccgggctgcg gctggcgcat      1020
     ctcgatctgc cggaaggcaa ctccatgcgc gcgccgggcg aaacgccggg cctgatggcg      1080
     ctggaaatcg ccattgatga gatggcaatc agggcgggcg tcgatccggt tgaattccgc      1140
     attcttaacg acacccaggt tgacccggcc aatccagagc gccctttctc gcgccgtcag      1200
     ttaatcgaat gcctgcgcac cggcgctgaa cgtttcggct ggcagcatcg tcacgccacg      1260
     ccgggacagg ttcgcgacgg caactggctg atcggcatgg ggatggcggc gggctatcgc      1320
     gacaacgtgg tcgtcccttc cggcgcgcgg gtgcagttcc atgccaacgg tacgctgacg      1380
     gtggaaaccg acatgaccga catcggcacc ggcagctaca ccatcattgc ccagacggcc      1440
     gccgagatgc tggggctgcc gctggagaag gtcgaggtac ggctgggcga ctccgccttc      1500
     ccggtctccg ccggttccgg cggccagtgg ggagcgaata cctctactgc gggcgtttat      1560
     gccgcctgtg taaaactgcg cgaaacaata gccgcgacgc tgggttttga cccggcgacg      1620
     gcgacctttg cggaagaaaa aatccacgcc gacggacgca gcgtagcgct acgcgaggcg      1680
     gcggcaaacg gcaccctcag cgcggaagat accattgagt ttggcgatct ggcgaagaaa      1740
     taccagcagt cgacctttgc cggtcacttt gtggaggtcg gcgttgacgt ggcgaccggc      1800
     gagatccgcg tgcggcggat gctggcggtc tgcgccgcag gccgcattct gaacccgaaa      1860
     accgcccgca gccaggtgat tggcgcaatg acgatgggga tcggcgcggc gctgatggag      1920
     gagctggcgg tggatacccg gcagggctat ttcgttaatc acgatctggc ggcctatgaa      1980
     gtgcccgtcc atgccgatat tccgcagcag gaggtgatct tccttgagga caccgatccc      2040
     atctcctctc cgatgaaggc caaaggcgtc ggcgagctgg ggctgtgcgg cgtcagcgcc      2100
     gccatcgcca atgccgttta taacgccacc ggcgtgcggg tgcgcgatta cccgatcagg      2160
     ctggacaaac tgctcagcgc gctaccggat gcggtataa                             2199
//

If you have problems or comments...

PBIL Back to PBIL home page