(data stored in ACNUC8465 zone)

EMBL: FN543502.PE391

FN543502.PE391       Location/Qualifiers
FT   CDS_pept        complement(424550..425122)
FT                   /transl_table=11
FT                   /locus_tag="ROD_03871"
FT                   /product="putative xanthine dehydrogenase
FT                   iron-sulfur-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03871"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87169"
FT                   /db_xref="GOA:D2TK39"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:D2TK39"
FT                   /protein_id="CBG87169.1"
FT                   /translation="MSNQGNTQGENHLPVTPPPETLSLTLNVNGEPQQLTVDTRTTLLD
FT                   ALREHLHLTGSKKGCDHGQCGACTVLLNGRRINACLTLAVMHEGAEITTIEGLGTPDDL
FT                   HPMQAAFVRHDGYQCGYCTPGQICSSVAMLKEIEEGIPSHVTLDLVSPPEMSADEIRER
FT                   MSGNICRCGAYSNILAAIEDAAGELKS"
     atgagcaacc aaggcaatac tcagggtgag aatcatttac ccgtaacgcc gccacctgaa        60
     accctttccc tgacgctgaa cgtcaatggc gaaccgcagc agttaaccgt ggacacccga       120
     acgacgttgc tggacgccct gcgcgaacat ctgcacctca ccggcagcaa aaaaggctgc       180
     gatcacggac agtgcggcgc ctgtaccgtt ctgctgaatg gtcgccggat caacgcctgc       240
     ctgaccctgg cggtaatgca tgagggcgcc gaaatcacca ctattgaagg gctcggcacg       300
     cctgacgatc tgcatcccat gcaggccgct tttgtccggc atgacggcta ccagtgcggc       360
     tactgcacgc cggggcagat ctgttcgtcg gtggcgatgc tcaaagagat cgaagagggc       420
     attcccagcc acgtcacgct ggatctggtt tctccgccgg agatgagcgc tgacgaaatc       480
     cgcgaacgca tgagcggcaa tatctgccgc tgcggggcct acagcaatat cctcgccgcc       540
     attgaagacg ccgccgggga gctgaaatca tga                                    573
//

If you have problems or comments...

PBIL Back to PBIL home page