(data stored in ACNUC8465 zone)

EMBL: FN543502.PE394

FN543502.PE394       Location/Qualifiers
FT   CDS_pept        431335..432735
FT                   /transl_table=11
FT                   /locus_tag="ROD_03901"
FT                   /product="putative terminal oxidase subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03901"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87172"
FT                   /db_xref="GOA:D2TK42"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="UniProtKB/TrEMBL:D2TK42"
FT                   /protein_id="CBG87172.1"
FT                   /translation="MDIDAFLLARIQFAFTVSFHIIFPAITIGLASYLAVLEGLWLKTN
FT                   NPVWRSLYQFWVKVFAVNFGMGVVSGLVMAYQFGTNWSGFSQFAGSITGPLLTYEVLTA
FT                   FFLEAGFLGVMLFGWNKVGPGLHFLSTCMVALGTLMSTFWILASNSWMHTPQGFEVVNG
FT                   QVVPVDWFAVIFNPSFPYRLLHMSVAAFLSSAMFVGASAAWHLLKGNDTPAIRKMFSMA
FT                   LWMAMLVAPVQALIGDMHGLNTLEHQPVKIAAIEGHWENRPDEPTPLTLVGWPDMEAEE
FT                   TRYALEIPALGSLILTHSLDKQVPALKDYPKDERPNSTIVFWSFRLMVGMGVLMILLGL
FT                   ASLWLRYKNRLYQSRPFMHFALWMGPSGLIAILAGWVTTEVGRQPWVVYGLQRTRDAVS
FT                   AHSTLQMSISLLAFFVVYSLVFGVGYLYMIRLIQKGPQPFEPPTSETDGRPARPISAVG
FT                   EPLDQEKR"
     atggatattg atgcgttttt gctggcacga atccagtttg cctttaccgt ttcttttcat        60
     attattttcc cggccattac cattggatta gccagttatc tggctgtact ggaaggcctt       120
     tggctgaaaa caaataatcc ggtctggcgc tcgttatacc agttctgggt gaaagtgttt       180
     gcggtgaatt tcggcatggg ggtggtgtcc gggctggtca tggcctatca gtttggcacc       240
     aactggagcg gattttccca gtttgccggt agtatcaccg gcccgttgct gacctatgaa       300
     gtattgacgg cattcttcct cgaagccggt ttcctcggag tgatgctgtt tggctggaat       360
     aaggtcggac cgggtctgca cttcctttcc acctgtatgg tcgcgctggg tacgctgatg       420
     tccaccttct ggatcctcgc ctcgaacagc tggatgcaca cgccgcaggg ctttgaagtg       480
     gtcaacggcc aggtggtgcc ggtggactgg ttcgccgtca tctttaaccc gtcatttccc       540
     taccgtctgc tgcatatgtc ggtggcggcc ttcctcagca gcgcgatgtt tgtcggcgcg       600
     tcggcggcct ggcacctgct gaagggcaac gatacgcccg ccatccgtaa aatgttttcg       660
     atggcgctgt ggatggccat gctggtggcg ccggtacagg cgttgattgg cgatatgcac       720
     gggctgaata cccttgagca tcagccggtg aaaatcgccg ccattgaagg gcactgggaa       780
     aacaggccgg acgaaccgac gccgctcacg ctggtgggct ggccggatat ggaggctgaa       840
     gaaacgcgct atgcgctgga gatccccgcc ttaggcagcc tgatcctcac tcacagcctc       900
     gataaacagg tgcctgcgct gaaagattac ccgaaagatg aacgccccaa ctcaaccatt       960
     gtgttctggt cgttccgcct gatggtcggg atgggcgtgc tgatgattct gctggggctc      1020
     gccagcctgt ggctgcgcta taaaaaccgg ctctatcagt cgcgtccgtt tatgcatttt      1080
     gccctgtgga tggggccatc ggggcttatc gccattcttg ccggttgggt gacgacggag      1140
     gtcgggcggc agccgtgggt ggtgtacggc ctgcagcgca cccgcgacgc cgtatcggcg      1200
     cacagcacct tacagatgag catcagcctg ctggccttct tcgtggtcta ttcgctggtg      1260
     ttcggcgtcg gctaccttta tatgatccgc ctgatccaga aggggccgca gccgtttgag      1320
     ccgccgactt cggaaaccga tggccgaccg gcacgaccca tctccgcggt aggagaaccg      1380
     ctcgatcagg agaaacgctg a                                                1401
//

If you have problems or comments...

PBIL Back to PBIL home page