(data stored in ACNUC8465 zone)

EMBL: FN543502.PE406

FN543502.PE406       Location/Qualifiers
FT   CDS_pept        complement(451327..452103)
FT                   /transl_table=11
FT                   /locus_tag="ROD_04021"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_04021"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87184"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D2TK54"
FT                   /protein_id="CBG87184.1"
FT                   /translation="MNITQIRNATQLITYGGKTFLIDPLLAPKGAYPGFPGTARAEIRN
FT                   PTVELPCDIDSLLQADALIVTHLHADHWDDVAAKVVPKDKPIYVQNARDAQTLRGQGFT
FT                   ALTVLAENTVFGEVTLRKTGGQHGSDRLYAIPKMAERLGEACGVIFTHPQEKTLYLAGD
FT                   TIWRAEVEASLTRYQPDVVVLNAGFAHVIGFGPIIMGAEDVLKTHFILPEAQIVATHME
FT                   AINHCLLTRAALREYARDNQIAEYVHVPEDGETLTF"
     atgaacatca cacaaattcg taacgccacg cagttaatta cctatggcgg taaaacgttt        60
     ctcatcgatc cgctgctggc gccaaagggg gcttaccccg gctttcccgg caccgcgcgc       120
     gcagaaatcc gtaatccaac cgtggaactg ccctgcgata ttgacagcct gctacaggct       180
     gatgccctga tcgtcaccca tctgcatgcc gatcactggg atgacgtcgc cgcgaaggtc       240
     gtaccgaaag acaaacccat ctacgtgcag aacgcacggg atgcgcaaac gctgcgcggg       300
     caagggttta ccgcgctgac cgtgctggcg gaaaataccg tctttggcga ggttacgctg       360
     cgtaaaaccg gcggtcagca cggttctgac cgactgtacg cgataccgaa aatggcggaa       420
     cgcttaggcg aggcctgcgg cgtgatcttt acccatccgc aggaaaaaac gctctacctg       480
     gcgggcgata cgatctggcg cgccgaggtc gaagccagtc tgacccgcta tcagccggac       540
     gtggtggtac tgaatgccgg tttcgcgcac gttatcggct tcgggccaat tataatgggc       600
     gcagaggatg tactgaaaac gcactttatc ctgccggagg cgcagatcgt ggcgacccat       660
     atggaagcca tcaaccactg cctgctgacg cgtgcggcgc tcagagagta tgcccgcgac       720
     aaccagattg cagaatatgt gcatgtcccg gaagatgggg aaaccctgac cttctaa          777
//

If you have problems or comments...

PBIL Back to PBIL home page