(data stored in ACNUC8465 zone)

EMBL: FN543502.PE429

FN543502.PE429       Location/Qualifiers
FT   CDS_pept        477935..478252
FT                   /transl_table=11
FT                   /locus_tag="ROD_04261"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_04261"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87207"
FT                   /db_xref="GOA:D2TKW6"
FT                   /db_xref="InterPro:IPR019732"
FT                   /db_xref="UniProtKB/TrEMBL:D2TKW6"
FT                   /protein_id="CBG87207.1"
FT                   /translation="MQHEFIVITSCFTGEGNRVMKNLIAELLLKLAQKEEESKELVAQV
FT                   EALEIIVTAMLRNMAQNEQDTLIQQVEGALDGVKPDASIPDDDRELLRQYVQKLLKHPR
FT                   Y"
     atgcagcatg agttcatagt gataacgtcc tgtttcacag gagaagggaa tagagtcatg        60
     aaaaatctca ttgctgagtt gttgcttaag cttgcccaga aagaagaaga gtcgaaagaa       120
     ctggttgctc aggtagaagc cttagagatt atcgtcacgg cgatgttacg taatatggcg       180
     caaaatgagc aggatacctt gattcagcag gtggaagggg cgcttgacgg cgtaaagccg       240
     gatgccagca ttcctgatga cgatagggaa ctgctgcgcc agtacgtaca aaaactgtta       300
     aaacatcctc gttattag                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page