(data stored in ACNUC8465 zone)

EMBL: FN543502.PE451

FN543502.PE451       Location/Qualifiers
FT   CDS_pept        504525..505916
FT                   /transl_table=11
FT                   /locus_tag="ROD_04501"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_04501"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87229"
FT                   /db_xref="GOA:D2TKY8"
FT                   /db_xref="InterPro:IPR025060"
FT                   /db_xref="UniProtKB/TrEMBL:D2TKY8"
FT                   /protein_id="CBG87229.1"
FT                   /translation="MKWMKALLCSALLSAAGTVAGSDEAKESPVDYATGVMLETTGASP
FT                   WYRLPLPQTVYEGSAWPDLRDVRVFNHAGETVPFALVAQKAQPVTPETMKLRLFPLDMS
FT                   PVAAREQGRQGESFVLRSKAGIEIQLNSDEVNASGQSYLLTLPEARQEPFSLAQLRLDW
FT                   RPPAGNWQGKASIYSSRDLRYWRSILEDAPLMDLTREGDRLKMDTISARLTLSTQGNRY
FT                   LLVILDAQSPALTINSVSAIADSRAPESERVVIGAQEHRVSDEEALWRWKQPQPLSSLS
FT                   IALQNEGVLPVALAWRSEENAAWQPLTKTVLYRLDGQRSQDIALSGQEVEAVRITTINA
FT                   RLPETLPAVSGARDSYQLVFNAQGKGPYMLAWGNRAAIRADIELDRLIPASLRKTHALN
FT                   DLPWAIPQQSVTPGGEARLSATSAAERQSQWQTLLVWGALILGVAVLALMAFRIWREVK
FT                   KDGGA"
     atgaaatgga tgaaagcatt gctatgtagc gctctgttga gcgcggcagg gacggtggcc        60
     ggtagcgacg aggcaaaaga gtcaccagtg gactatgcca ccggtgtgat gttggagacg       120
     acaggcgcat cgccctggta tcgtctgccg ctgccgcaga cggtgtatga gggtagcgcc       180
     tggccggatt tacgcgatgt gcgggtcttt aaccatgcgg gggaaacggt gccgtttgcg       240
     ctggtggcgc agaaagcgca gcccgtgacg ccagaaacga tgaaattgcg gctctttccg       300
     ctggatatgt cgcctgtagc ggcgcgtgaa caggggcggc agggggaatc ttttgtctta       360
     cgctcgaagg ccggcattga aattcagttg aacagcgacg aggtgaatgc gtccggacag       420
     agctatttac tgacgctgcc ggaagcgcgg caagagccgt tttcactggc gcagcttcgc       480
     ctggactggc gtccgcccgc aggcaactgg cagggcaaag cctcgatcta tagcagccgt       540
     gatttacgct actggcgatc catactggaa gacgcgccgc tgatggatct gacgcgcgaa       600
     ggtgatcggc taaaaatgga cactatcagc gcccgtctga cgctctcaac gcaggggaat       660
     cgttatctgc tggtgattct tgatgcacaa agcccggcgt tgacgataaa cagtgtaagc       720
     gctattgccg acagccgcgc gccggagtcc gaacgcgtgg tgataggcgc tcaggagcat       780
     agagtttcag atgaagaggc gctctggcgc tggaagcaac cgcagccgct gagttcgctt       840
     agcatcgcat tgcagaatga gggggtttta ccggtggcgc tggcctggcg aagtgaggaa       900
     aacgccgcct ggcagccgtt gacgaaaacc gtgttgtacc ggctggacgg acagcgctct       960
     caggatattg ctctttccgg ccaggaggtg gaggccgtca gaatcactac catcaacgcc      1020
     cgactgccgg agacattgcc tgcggtgagc ggggcgcggg acagctacca actggtattt      1080
     aatgcccagg ggaagggacc ttacatgctg gcctggggaa accgggccgc catcagagcc      1140
     gatattgaac tggacaggtt aattccggcg tcactgcgca aaacgcatgc gttgaatgac      1200
     ctgccgtggg cgattcccca gcagagcgtc acgcctggcg gcgaagcgcg gctgagtgcg      1260
     acatcggcgg ctgagcgaca aagccagtgg caaacgctgc tggtctgggg agcgctgatt      1320
     ctgggcgtcg ccgtactggc gctgatggcg tttcgtatct ggcgggaagt gaagaaagac      1380
     ggcggggcat aa                                                          1392
//

If you have problems or comments...

PBIL Back to PBIL home page