(data stored in ACNUC8465 zone)

EMBL: FN543502.PE473

FN543502.PE473       Location/Qualifiers
FT   CDS_pept        524764..526212
FT                   /transl_table=11
FT                   /locus_tag="ROD_04721"
FT                   /product="thiamine biosynthesis protein ThiI"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_04721"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87251"
FT                   /db_xref="GOA:D2TL10"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR003720"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020536"
FT                   /db_xref="InterPro:IPR026340"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:D2TL10"
FT                   /protein_id="CBG87251.1"
FT                   /translation="MKFIIKLFPEITIKSQSVRLRFIKMLTGNIRNVLKHYDETLAVVR
FT                   HWDNIEVRARDENQRLAIRDALTRIPGIHHILEVEDVPFTDMHDIFEKALAEYRDRLEG
FT                   KTFCVRVKRRGKHEFSSIEVERYVGGGLNQHIESARVKLTNPDVTVHLEVEDDRLLLIK
FT                   GRYEGIGGFPIGTQEDVLSLISGGFDSGVSSYMLMRRGCRVHYCFFNLGGAAHEIGVRQ
FT                   VAHYLWNRYGSSHRVRFVAINFEPVVGEILEKVDDGQMGVVLKRMMVRAASKVAERYGV
FT                   QALVTGEALGQVSSQTLTNLRLIDNVSDTLILRPLISYDKEHIINIAREIGTEDFARTM
FT                   PEYCGVISKSPTVKAVKSKIEAEEENFDFSILDRVVEEATNVDIRDIAQQTAQEVVEVE
FT                   TVSGFGPNDVILDIRSVDEQDDKPLRVEGVDVVTLPFYKLSTKFGDLDQSKTWLLWCER
FT                   GVMSRLQALYLREQGFENVKVYRP"
     atgaagttta tcattaaatt gttcccggaa atcactatca aaagccaatc tgtgcgtttg        60
     cgctttataa agatgctgac cgggaacatt cgtaacgttt taaaacacta tgatgagacc       120
     ctcgcggttg tccgccactg ggataacatc gaagttcgcg ccagagatga aaaccagcgt       180
     ctggcgatcc gcgacgcgct gacccgcatt ccgggcatcc accatattct cgaagtggaa       240
     gacgtgccgt ttaccgatat gcacgatatc ttcgagaaag cgctggcgga atatcgcgat       300
     cggctggagg gcaaaacctt ctgcgtgcgc gtgaagcgtc gcggcaaaca tgagtttagc       360
     tccatcgaag tggaacgtta cgttggcggc ggtttaaatc agcatatcga atccgcgcgc       420
     gtgaagctga ctaacccgga cgtgacggtg catctggaag tggaagacga tcgcctgctg       480
     ttgatcaaag gtcgttacga aggcatcggc ggcttcccga ttggcaccca ggaagatgtg       540
     ctgtcgctga tttccggcgg cttcgactcc ggcgtctcca gctatatgct gatgcgtcgc       600
     ggctgccgcg tacactactg cttctttaac ctcggcggcg cggcgcacga aattggcgtt       660
     cgccaggtgg cgcactattt gtggaaccgc tacggcagct cgcaccgcgt acgctttgtg       720
     gcgattaact ttgaaccggt ggtcggcgaa atccttgaga aggttgatga cggtcagatg       780
     ggcgtggtgc ttaagcgcat gatggtgcgc gcggcgtcga aagtggcgga gcgctatggc       840
     gtgcaggcgc tggtgaccgg tgaagcgctg ggccaggttt ccagtcagac cctgaccaat       900
     ctgcgtttga tcgacaatgt gtcggatacc ctgattctgc gtccgctgat ttcgtatgac       960
     aaagagcaca tcatcaatat cgctcgtgag attggcaccg aggattttgc ccgcaccatg      1020
     ccggaatact gcggcgtgat ctcaaaaagc ccgaccgtga aggccgtcaa atcgaagatc      1080
     gaagcggaag aagaaaactt cgatttcagc attctcgaca gggtggtgga agaggcgacc      1140
     aacgtcgata tccgtgatat cgcgcagcag accgcgcagg aggtggttga agtcgagacg      1200
     gtcagcggct ttggcccgaa cgacgtgatt ctggatattc gctctgttga tgaacaggac      1260
     gacaaaccgc tgcgggtgga aggtgtggac gtggtgacgc tgccgttcta caagctgagc      1320
     accaaattcg gcgatctcga tcagagtaaa acttggctgc tgtggtgcga gcgtggcgtg      1380
     atgagccgtt tacaggcgct gtatctgcgc gagcagggtt ttgagaacgt gaaggtatat      1440
     cgcccgtaa                                                              1449
//

If you have problems or comments...

PBIL Back to PBIL home page