(data stored in ACNUC8465 zone)

EMBL: FN543502.PE481

FN543502.PE481       Location/Qualifiers
FT   CDS_pept        complement(533977..534297)
FT                   /transl_table=11
FT                   /locus_tag="ROD_04801"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_04801"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87259"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR012577"
FT                   /db_xref="UniProtKB/TrEMBL:D2TL18"
FT                   /protein_id="CBG87259.1"
FT                   /translation="MIYEKRTYTINPLKMAEWLALYKSDAYAVQTEHLGKLIGFFFTEI
FT                   GVVNQVVHIWAWESLDDRLMRRARMAQDKRWQTFSRKNRELAAVERLESVLMRPTDFSP
FT                   LQ"
     atgatttacg aaaaacgtac ctatacgatc aacccgctga aaatggccga atggctggcg        60
     ctgtacaaaa gcgacgctta cgcggtgcag accgaacatc tcggcaaact gatcggcttt       120
     ttctttactg aaatcggcgt ggtgaatcag gttgtgcaca tctgggcctg ggagagtctg       180
     gacgatcgct taatgcgccg cgcgcggatg gcgcaggata agcgctggca gaccttttcg       240
     cgtaagaacc gcgaactggc ggcggtcgaa cgccttgagt cggtgctgat gcgtccaacc       300
     gatttctctc cgctgcaata a                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page