(data stored in ACNUC8465 zone)

EMBL: FN543502.PE482

FN543502.PE482       Location/Qualifiers
FT   CDS_pept        complement(534294..535988)
FT                   /transl_table=11
FT                   /locus_tag="ROD_04811"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_04811"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87260"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D2TL19"
FT                   /protein_id="CBG87260.1"
FT                   /translation="MKSWDVIVIGSGAAGFAAAVTACCQGLSVLMLEKASQFGGTSAIS
FT                   GGAVWINDTDQARNLGKSGPAEEMKTYLRTIIGDAHYRPEMIDAFVNAGREALAFLERE
FT                   GAVKYSLRPLSPDYYPDEPGAVDVGRALEVIEYDGRKLGQHFKALRSPPPGMLLFGGMM
FT                   VNRVDIHHFLSMRRSWRSLVHCARLLLRYGRDRLRYPRGTRLAMGNALIARMASLALRK
FT                   GLELELNVDVKTLTEQQGRVTGVEIERDGKTLTLHARRGVVLATGGFAAGRIAPQFRPA
FT                   TRQHYTMSPATNDGAAFRLGQPLGVQQGADLPSNFFWAPVSVLRRPDGSEERFPHLVTD
FT                   RAKPGVIAVNQHGMRFVNEADSYHHFVSAMQQRPENAPCFLLCDAQAMKRYGLGLARPA
FT                   PVNNDALVSAVYLYRAESLSALAQQLDIDPQQLEQTVARYNHDAQTGNDTAFHKGGNSY
FT                   NRTLGDPAHHPDACNAPLLRAPFYAIRIFTGDLGTSRGLVTTADAQVINQQGQPVGGLY
FT                   AVGNDMDSIMAGTYPGPGITLGPALTFGYLAAMHMTQTSPLNAGEAA"
     atgaaaagct gggacgttat tgtcatcggc agcggtgcgg cgggctttgc cgctgccgtc        60
     accgcctgct gccagggact ctcggtgctc atgctggaaa aggcgtcgca atttggcggc       120
     acttcggcta tctccggcgg cgctgtctgg atcaacgata ccgaccaggc gcgcaatctc       180
     ggcaaaagcg gcccggctga agagatgaaa acctatctgc gcaccattat cggcgacgcc       240
     cactatcgcc cggaaatgat agatgctttt gttaacgccg gtcgcgaagc gctggctttt       300
     cttgagcgtg aaggcgcggt gaaatacagc ctgcgccccc tgtcgccgga ctactacccc       360
     gatgagccgg gggcagttga tgtgggtcgc gcgctggagg taattgaata cgacggacgc       420
     aagctcggcc agcacttcaa agcgctgcgc tcgccgccgc cgggcatgct gctgttcggc       480
     ggtatgatgg tcaaccgcgt cgatattcac cattttctct ctatgaggcg ctcgtggcgg       540
     tcgctggtcc actgcgccag actgctgctg cgctatggcc gcgaccgcct gcgctacccg       600
     cgcggcaccc gcctggcgat gggtaacgcg ctgattgccc gcatggcgtc gctggcgctg       660
     cgcaaagggc tggaactgga gcttaacgtc gacgtaaaaa cgttgactga acagcagggt       720
     cgggtcacag gcgtggaaat tgagcgcgac ggcaaaacgc ttaccctgca cgcccgtcgc       780
     ggcgtggtgc tggccaccgg gggcttcgcc gccggacgta ttgcgccgca attccgcccc       840
     gccacccggc agcactacac gatgtcgccc gcgaccaacg acggcgcggc gtttcgatta       900
     ggtcagcctc tgggtgtaca gcagggggcc gacctgcctt ccaacttttt ctgggcgccg       960
     gtttcggtgt tacgccgccc ggacggcagc gaggaacgct ttccgcacct ggtgaccgac      1020
     cgggccaagc ctggggtgat cgccgtcaac cagcatggta tgcgcttcgt caacgaagcg      1080
     gactcctacc accactttgt cagcgccatg cagcagcggc cagaaaacgc cccctgcttt      1140
     ctgttgtgcg acgcgcaggc gatgaaacgc tacggactgg ggctggcgcg cccggcaccg      1200
     gtcaacaacg atgcgctggt cagcgccgtt tatctgtatc gggcggaaag cctcagcgcg      1260
     ctggcccaac agctggatat tgacccacag cagcttgagc aaaccgttgc acgctataac      1320
     cacgatgcgc aaaccggcaa cgacaccgcg tttcataaag ggggcaacag ctacaaccgc      1380
     accctgggcg atccggcgca ccaccctgac gcctgtaacg cgccgctgct cagggcgcca      1440
     ttttatgcca tcaggatctt caccggcgat ttaggcacgt cgcgcgggct ggtcacgaca      1500
     gccgacgcgc aggtcatcaa ccagcagggc cagcctgttg gcgggctgta tgccgttggc      1560
     aacgatatgg actcaataat ggccggcacc taccccggac cgggaatcac ccttggcccc      1620
     gcgctcacct tcggctatct cgccgccatg catatgacgc aaacatcccc actcaacgca      1680
     ggagaagcag catga                                                       1695
//

If you have problems or comments...

PBIL Back to PBIL home page