(data stored in ACNUC8465 zone)

EMBL: FN543502.PE5

FN543502.PE5         Location/Qualifiers
FT   CDS_pept        complement(5147..5920)
FT                   /transl_table=11
FT                   /locus_tag="ROD_00041"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00041"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86783"
FT                   /db_xref="InterPro:IPR005583"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGI1"
FT                   /protein_id="CBG86783.1"
FT                   /translation="MLILISPAKTLDYQSPLATTRYTLPELLDHSRQLIDVAKKLSAPQ
FT                   IGKLMGISDKLADLNATRFHDWQPDFTPDNARQAILAFKGDVYTGLQAETFSEADFDFA
FT                   QQHLRMLSGLYGVLRPLDLMQPYRLEMGIRLENAKGKDLYQFWGDVITDKLNEALAAQG
FT                   DQVVINLASDEYFKSVKPQKLNAELIKPVFLDEKNGTFKVISFYAKKARGLMSRYIIEN
FT                   RLTKPEQLMDFSSEGYFFDEAASGHSELVFKRHEQ"
     atgctgattc tgatttcacc tgcaaaaacg ctcgattatc aaagcccgct ggcaaccacg        60
     cgctataccc tgcccgaact gctggatcac tcccggcagc tgatcgacgt agcgaaaaag       120
     ctctcagcgc cgcaaatcgg taagctgatg ggcatcagcg ataagctcgc cgatctgaac       180
     gccacccgtt ttcacgactg gcagccagac ttcacgccgg acaatgcgcg ccaggccatt       240
     cttgccttta aaggcgatgt ctataccggt ttacaggcgg aaaccttcag cgaagcggat       300
     tttgatttcg cccagcagca tttgcgtatg ctttcaggtc tgtacggcgt tctgcgtccg       360
     ctggatctga tgcagccgta tcgccttgag atgggcattc gtctggagaa tgcgaaaggg       420
     aaagatctgt atcagttctg gggtgatgtg attaccgata agctcaatga ggcgctggcg       480
     gcgcagggcg atcaggtggt gataaacctt gcctccgatg aatattttaa atccgtgaag       540
     ccgcagaaac tgaatgcgga gttgattaag ccggtctttc ttgatgaaaa gaacggcacg       600
     tttaaagtga tcagcttcta tgccaaaaaa gcgcgcggcc tgatgagccg ctacatcatt       660
     gaaaaccgtc tgacgaagcc tgaacagctg atggacttca gcagcgaagg ctatttcttt       720
     gatgaagccg cgtcagggca tagcgagctg gtatttaagc gccacgaaca gtaa             774
//

If you have problems or comments...

PBIL Back to PBIL home page